DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and stag1a

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_001349269.1 Gene:stag1a ZFINID:ZDB-GENE-070912-448 Length:1258 Species:Danio rerio

Alignment Length:1131 Identity:511/1132 (45%)
Similarity:718/1132 (63%) Gaps:91/1132 (8%)


  Fly    29 ESTSDADSPTKRMTRLRARGGVRDKPPIIDDDEDDFFAPIARKRKTPATRKGPTERKERVERPRK 93
            :|..|..|.:..|:.|              ||..|  ..|.:||..|.  :.|...|    :|||
Zfish    14 DSGQDTVSLSMSMSEL--------------DDPGD--GKIKKKRGRPG--RPPAANK----KPRK 56

  Fly    94 EP-------VDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQYKANRETALVALM 151
            .|       |.:|......|::....|..:|:.:|:..|:.:.|:||.|||.||.:|:.||:.|:
Zfish    57 SPSEKGFMAVQRGRKANGISQQNGEGDPVTLFEVVKQGKSAMQSVVDDWIESYKQDRDLALLDLI 121

  Fly   152 QFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRKFKNNFCDFVQTLV 216
            .|||..|||||.:..::...:.:..|||:|||||||:||:|||.:||..|:||:.|||:|:..|:
Zfish   122 NFFIQCSGCKGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTISGPLWKKFRYNFCEFICVLI 186

  Fly   217 KQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVALLVSNNFDNAAKQF 281
            :|||||||||:::||.|||||||||||||||||||:||||||||||||:|||.:|.|.||..:|:
Zfish   187 RQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSINQDNTQRQY 251

  Fly   282 EAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDSLPDIRAICMAEIG 346
            ||||.|...:||:::|:.|:.||.||:||.|||::|:..:||.:|||||||::.:|||||:.|||
Zfish   252 EAERSKIVGKRATEKLELLLQKRKELQENQDEIENMMNSIFKGIFVHRYRDAIAEIRAICIEEIG 316

  Fly   347 IWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLELFTSKFKDRIVAM 411
            :||:.|...||:||||||:||||||:.|||||:||::|..||...||..||||||::||||||:|
Zfish   317 VWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQNLYTNRELFPKLELFTNRFKDRIVSM 381

  Fly   412 TLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAEFLNVRLF--HLTA 474
            |||||::|:|.|::||..||:...:.|:::|||.||.||||:||.||.||.|||:.:||  | ..
Zfish   382 TLDKEYDVAVEAIRLVTLILQGSEDALSNEDCENVYHLVYSAHRPVAVAAGEFLHRKLFSRH-DP 445

  Fly   475 DMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFIDSN-DMVRDWECMTDLLLEEP 538
            ..||...||.....||..|:|.||.||:|||||||.||||||..:|: ::::||||||:||||||
Zfish   446 QAEEALAKRRGRSSPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKDWECMTELLLEEP 510

  Fly   539 GPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDEKAKLTEHFIVT 603
            ...||||.::|||:|||:.|.:::|:|....||||.:.:: .|:|||.|...|:|.|||||||:.
Zfish   511 VQGEEVLADRQESSLIELTVCTIRQAAEAHPPVGRGTGKR-VLTAKERKMQIDDKNKLTEHFIMA 574

  Fly   604 LPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHTGREVLETCAKT 668
            ||.||.|||.||||:||||.:||||||::|:..|.|.:|.|||.:|..|:..||..||||.|:||
Zfish   575 LPMLLSKYQTDSEKVANLLQIPQYFDLDVYSAGRMEKHLDALLKQIKFVVEKHTDTEVLEACSKT 639

  Fly   669 LECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIYNITITLKVLSIL 733
            ...||:|......|.:||||.:|:...:::..::||   |:|..|..::|||||:..|||.|:..
Zfish   640 YSILCSEEYTIMNRVDIARSQLIDELADRFNHSVEE---LLQAGEEADDDDIYNVLSTLKRLTAF 701

  Fly   734 YSSHNLNPWELFKSLFQ----DVEEAQSKENIDRCLPNEALVYCIEACYFSISWGLQYVENECES 794
            :::|:|..|:.|.:.::    .:|:..        :|.:..|..::..::||.|.|         
Zfish   702 HNAHDLTRWDFFGNCYRLLRTGIEQGS--------MPEQIAVQALQCSHYSILWQL--------- 749

  Fly   795 VNVTE------VVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSEIEH 853
            |.:||      .:..||..:.:|:..|.:...:..| .::|.|:..:||||:|||.:|.....|.
Zfish   750 VKITEGAPSKDDLLALRRVVKSFLAICQQCLSNVNT-PVKEQAFMLLCDLLMIFSHQLTTGSREG 813

  Fly   854 IRGLEY--KSRMDEHLILDNFVQHYVF--------SLKQDVAQDETRIEELHKKRNFLACYCKLV 908
            ::.|.:  ...:...|:  ||:..:||        |::.|...:..:||.|||:||.||.:.||:
Zfish   814 LQPLVFIPDGTLQNELL--NFILDHVFIDQDDENQSIEGDEEDEANKIEALHKRRNLLAAFSKLI 876

  Fly   909 VYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKSL-QEQSED 972
            :|:||....||.|||:|:|.|||||||||.||.|.|:.:|:..|.||:|||..:|..| |:|..:
Zfish   877 IYDIIDMPAAADIFKHYMKYYNDYGDIIKETLSKTRQTDKILCAKTLILSLQQLFNELIQDQGPN 941

  Fly   973 GIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFAAN-KEPDDPVRAPTRLLFL 1036
              :.::|.....:||||:|||||||.|.||.||:||.:|:.||.||.. :.|......|..|.||
Zfish   942 --LDRTSSHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNPKGAEYPPPNLAFL 1004

  Fly  1037 EVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLL-HGETDQAPV-----A 1095
            |||.||:.|||:||||.:.::|:|.:...|...|.:.|.|||.|||||| .|:.|:..:     :
Zfish  1005 EVLCEFSSKLLRQDKKTVHAYLEKFMTEQMMERREDIWLPLISYRNSLLTGGDEDRMSITSGSSS 1069

  Fly  1096 SKRAYTRKRRD----HDEEEEEEEDE 1117
            ||....|.::.    |.:..|||..|
Zfish  1070 SKAGSIRSKKGRPPLHKKRIEEESME 1095

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 72/108 (67%)
stag1aNP_001349269.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62829260
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H21191
Inparanoid 1 1.050 920 1.000 Inparanoid score I339
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 O PTHR11199
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.