DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and stag1b

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_692120.3 Gene:stag1b ZFINID:ZDB-GENE-030131-1393 Length:1256 Species:Danio rerio

Alignment Length:1130 Identity:515/1131 (46%)
Similarity:729/1131 (64%) Gaps:75/1131 (7%)


  Fly    22 LHSD--ALNESTSDADSPTKRMTRLRARGGVRDKPPIIDDDEDDFFAPIARKRKTPATRKGPTER 84
            ::||  .|.:|::|....|..:....:.         :||.|   .....:||..|. ::|...:
Zfish     2 INSDFPVLQDSSNDGQGDTISLAMSVSE---------LDDPE---VGKGKKKRGRPG-KQGAANK 53

  Fly    85 KERVERPRKEPVDKG-------HHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQYKAN 142
            |     .|:.|||||       .|:..:.     ||.::|:.:|:..|:.:.|::|.|||.||.:
Zfish    54 K-----ARRSPVDKGGRRPNGVAHQNGEG-----TDPSTLFEVVKQGKSAMQSVIDDWIESYKQD 108

  Fly   143 RETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRKFKNN 207
            |:.||:.|:.|||:.|||||.:..::...:.:..|||:|||||||:||:|||.|:|.||:||:.|
Zfish   109 RDLALLDLINFFIHCSGCKGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMTGPQWKKFRYN 173

  Fly   208 FCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVALLVSN 272
            ||:|:..|::|||||||||:::||.|||||||||||||||||||:||||||||||||:|||.:|.
Zfish   174 FCEFIMVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSI 238

  Fly   273 NFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDSLPDI 337
            |.||..:|:||||.|...:||:::|:.|:.||.||:||.|||::|:..:||.:|||||||::.:|
Zfish   239 NQDNTQRQYEAERNKVAGKRANEKLELLLEKRKELQENQDEIENMMNSIFKGIFVHRYRDAIAEI 303

  Fly   338 RAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLELFTS 402
            ||||:.|||:||:.|...||:||||||:||||||:.|||||:||::|..||...||..||||||:
Zfish   304 RAICIEEIGVWMKLYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQTLYTNRELYPKLELFTN 368

  Fly   403 KFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAEFLNV 467
            :||||||:||||||::|:|.|::||..||....:.|:::|||.||.||||:||.||.||.|||:.
Zfish   369 RFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEDALSNEDCENVYHLVYSAHRPVAVAAGEFLHR 433

  Fly   468 RLF--HLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFID-SNDMVRDWEC 529
            :||  | ....||...||.....||..|::.||.||:|||||||.||||||..| |:|:::||:|
Zfish   434 KLFSRH-DPQAEEALAKRRGRNSPNGNLIKMLVLFFLESELHEHAAYLVDSLWDSSHDLLKDWDC 497

  Fly   530 MTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDEKA 594
            |.:||||:|...||||.::.||.|||:||.:::|:|....||||.:.:: .|:|||.|...|:|.
Zfish   498 MVELLLEDPVQGEEVLGDRHESALIELMVCTIRQAAEAHPPVGRGTGKR-VLTAKEKKTQIDDKN 561

  Fly   595 KLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHTGR 659
            :||||.||.||.||.|||.|:||:||||.:||||||.:|::.|.|.:|.|||.:|..|:..|...
Zfish   562 RLTEHLIVALPMLLSKYQVDAEKVANLLQIPQYFDLEVYSSGRMEKHLDALLKQIRVVVEKHAEM 626

  Fly   660 EVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIYNIT 724
            ||||.|:||...||:|......|.:||||.:|:...:|:..::|:   |:|..|..::|||||:.
Zfish   627 EVLEACSKTYSILCSEEYTIMNRVDIARSQLIDELTDKFAHSVED---LLQEGEEADDDDIYNVL 688

  Fly   725 ITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDR-CLPNEALVYCIEACYFSISWGLQYV 788
            .|||.|:..:::|:|..|:|||:.::.:     |..|:: .:|.:..|..::..::||.|.|..:
Zfish   689 STLKKLTAFHNAHDLTKWDLFKNCYRLL-----KMGIEQGSMPEQIAVQALQCSHYSILWQLVKI 748

  Fly   789 ENECESVNVTEVVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSEIEH 853
            ...|.|.:  :::| ||..:.:|:..|.:...:..| .::|.|:..:||||:|||.:|.....|.
Zfish   749 TEGCPSKD--DLLA-LRRVVKSFLAVCQQCLSNVNT-PVKEQAFMLLCDLLMIFSHQLVSGGREG 809

  Fly   854 IRGLEYK---SRMDEHLILDNFVQHYVF--------SLKQDVAQDETRIEELHKKRNFLACYCKL 907
            ::.|.:.   |..:|.|   |||..:||        |::.|...:..:||.|||:||.||.:|||
Zfish   810 LQPLVFNPDGSLQNELL---NFVLDHVFIDQDDENQSMEGDEEDEANKIEALHKRRNLLAAFCKL 871

  Fly   908 VVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKSL-QEQSE 971
            ::|:|:....||.|||.|:|.|||||||||.||.|.|:::|:..|.||:|||..:|..| |:|..
Zfish   872 IIYDIVDMPAAADIFKQYMKYYNDYGDIIKETLSKTRQMDKIQCAKTLILSLQQLFNELIQDQGP 936

  Fly   972 DGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFAAN-KEPDDPVRAPTRLLF 1035
            :  :.::|.....:||||:|||||||.|.||.||:||.:|:.||.||.. ..|..|...|..|.|
Zfish   937 N--LDRTSSHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKVPNPKGPEYPPPNLAF 999

  Fly  1036 LEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLLHGETDQ-------AP 1093
            ||||.||:.|||:||||.:.|:|:|.:...|...|.:.|.|||.||||||.|..|.       |.
Zfish  1000 LEVLCEFSSKLLRQDKKTVHSYLEKFMTEYMMERREDVWLPLIAYRNSLLTGGDDDRLSVTTGAS 1064

  Fly  1094 VASKRAYTRKRRDHDEEEEEEEDEE 1118
            ..||.:..|.:|....:.:...|||
Zfish  1065 STSKASTVRSKRGRPPQHKRRPDEE 1089

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 73/108 (68%)
stag1bXP_692120.3 IRR1 10..>394 CDD:227824 206/407 (51%)
STAG 156..264 CDD:285686 73/108 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62864637
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 1 1.000 H21191
Inparanoid 1 1.050 920 1.000 Inparanoid score I339
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T597592
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.