DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and stag2b

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_005173250.1 Gene:stag2b ZFINID:ZDB-GENE-030131-2785 Length:1276 Species:Danio rerio

Alignment Length:1089 Identity:494/1090 (45%)
Similarity:700/1090 (64%) Gaps:57/1090 (5%)


  Fly    58 DDDEDDFFAPIARKRKTPATRKGPTERKERVERPRKEPVDK--GHHERIDSEREITTDENSLYYI 120
            |.|:.|....|..|.|....:|||.|:.:.:.:    .|.:  |||:....|..:      |:.:
Zfish    26 DFDDPDGRNAIIGKGKAKKGKKGPGEKGKGMGK----GVGRMNGHHQENGMENVM------LFEV 80

  Fly   121 VRHSKNPIASIVDQWIEQYKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEF 185
            ||..|:.:.|:||.|||.||.:|:.||:.|:.|||..|||||.:|.::...:.::.|||:|||||
Zfish    81 VRLGKSAMQSVVDDWIESYKHDRDVALLDLINFFIQCSGCKGVVSGEMFRNMQNSEIIRKMTEEF 145

  Fly   186 DEESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRH 250
            ||:||:|||.|:|.||:|||::||:|:..||:|||||||||:::||.||||||||||||||||||
Zfish   146 DEDSGDYPLTMTGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRH 210

  Fly   251 TATLAAMKLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIK 315
            |:||||||||||||:|||.:|.|.||..:|:||||.|...:||:|||:.|:.||.||:||.|||:
Zfish   211 TSTLAAMKLMTALVNVALNLSINMDNTQRQYEAERNKMIGKRANDRLELLLQKRKELQENQDEIE 275

  Fly   316 SMLTYMFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRC 380
            :|:..:||.||||||||::.:|||||:.|||:||:.|...||:||||||:|||:|||.|||||:|
Zfish   276 NMMNAIFKGVFVHRYRDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKC 340

  Fly   381 LQSLLPLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEI 445
            |.:|..||...||..|||||||:||||||:||||||::|:|.|:||:..:|....|:|..:|||.
Zfish   341 LTALQGLYHNRELNAKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLHSSDEVLTAEDCES 405

  Fly   446 VYELVYSSHRGVAQAAAEFLNVRLF-HLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEH 509
            ||.||||:||.||.||.|||..:|| |...:.:....:||: :..|..|::..|.||:|||||||
Zfish   406 VYHLVYSAHRPVAVAAGEFLFKKLFSHRDPEDDSMPKRRGR-QSVNANLIKTTVFFFLESELHEH 469

  Fly   510 GAYLVDSFID-SNDMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGR 573
            .||||||..| :.::::|||||..|||:||.|.||.|.::||:.||||::.:::|:|....||||
Zfish   470 AAYLVDSMWDCAAELLKDWECMISLLLDEPLPGEEALTDRQETALIEILLCTIRQAAECHPPVGR 534

  Fly   574 ASNRKCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQ 638
            .:.:: .|:|||.|...|::.::||.|.:.||:||.||..|:||:.|||.:||:|||.:|||.|.
Zfish   535 GTGKR-VLTAKEKKTQLDDRTRMTELFAIALPALLAKYSVDAEKVTNLLQLPQFFDLEIYTTGRL 598

  Fly   639 EGNLQALLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIE 703
            |.:|.:||.:|.:::..||..:|||.|:||...||.|....:.|.:||||.:::..|:|:...:|
Zfish   599 EKHLDSLLRQIREIVEKHTDTDVLEACSKTYHSLCNEEFTIFNRVDIARSQLLDEQVDKFNKLLE 663

  Fly   704 EWRNLIQGEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNE 768
            ::   :|..|.|:|||.|.:..|||.:|..|::|:|:.|:||.|.::.:.  ...||.|  :|.:
Zfish   664 DF---LQEGEDPDEDDAYQVLSTLKRISAFYNAHDLSKWDLFTSNYKLLN--TGIENGD--MPEQ 721

  Fly   769 ALVYCIEACYFSISWGLQYVENECESVNVTEVVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQ 833
            .:|:.::..::.|.|.|..|...|..   .|.:..||..:..|...|........|. ::|.|:.
Zfish   722 IVVHALQCTHYVILWSLAKVSEGCYK---KEDMLTLRKQMRAFCLMCQRYLTSVNTA-VKEQAFT 782

  Fly   834 SICDLLIIFSDKLARSEIEHIRGLEYKSRMDEHLILDNFVQHYVF------SLKQDVAQDET--R 890
            .:||||:|||.::.....|.:..|.|.........|.||:..:||      |...|..||:.  :
Zfish   783 ILCDLLLIFSHQIISGGREALEPLVYTPEASLQSELLNFILDHVFIDQDEDSNSTDGQQDDEAGK 847

  Fly   891 IEELHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTL 955
            ||.|||:||.||.||||::||::.....|.|||.|::.|||||||||.|:.|.|:|:|:..|.||
Zfish   848 IEALHKRRNLLAAYCKLIIYNVVEMSTGADIFKQYMRYYNDYGDIIKETMSKTRQIDKIQCAKTL 912

  Fly   956 LLSLITVFKSLQEQSEDG-IVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFA- 1018
            :|||..:|..:  .||.| ...:||..|..:||||:||:||||.|.:|.||::|.:|:.||.|| 
Zfish   913 ILSLQQLFNEM--LSELGPSFDRSSSAFCGIKELARRFSLTFGLDQLKTREAIAMLHKDGIEFAF 975

  Fly  1019 --ANKEPDDPVRAPTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYR 1081
              ||.:.|.  ..|..|.||::|:||:.||::|||:.:..:|::.:...|...|.:.|.|||.||
Zfish   976 KEANPQGDG--HPPLNLAFLDILSEFSSKLMRQDKRTVHMYLERFMTFQMALQREDCWLPLISYR 1038

  Fly  1082 NSLLHGETDQ------------APVASKRA--YTRKRRDHDEEEEEEED 1116
            |||..|..|.            :.|.||:|  .|.||:..:||.....:
Zfish  1039 NSLQAGGDDDTMSVVSGISSRGSSVRSKKAKPATAKRKLPEEESSSSSE 1087

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 76/108 (70%)
stag2bXP_005173250.1 STAG 150..258 CDD:312124 76/108 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62879601
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 920 1.000 Inparanoid score I339
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T597592
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 LDO PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.