DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and Stag3

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_058660.2 Gene:Stag3 MGIID:1355311 Length:1240 Species:Mus musculus

Alignment Length:1120 Identity:428/1121 (38%)
Similarity:672/1121 (60%) Gaps:75/1121 (7%)


  Fly    25 DALNESTSDADSPTKRMTRLRARGGVRDKPPIIDDDEDDFFAPIARKRKTPATRKGPTERKERVE 89
            |..::.|::.|||:...                |.|.:|......:||......|.....|.|.:
Mouse    46 DRDSQGTAEWDSPSTNE----------------DSDFEDSLRRNVKKRAAKQPPKAVPAAKHRKK 94

  Fly    90 RPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQYKANRETALVALMQFF 154
            :.|......|.:|.:.|       .|.|:..|:.:::.:.|:||:|::.||.:.....:.|:.||
Mouse    95 QSRIVSSGNGKNESVPS-------TNYLFDAVKAARSCMQSLVDEWLDNYKQDENAGFLELINFF 152

  Fly   155 INASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQC 219
            |.|.|||..::.::...:.::.||:.:||||:|:||:|||...|..|:||:.:||:||:|||.||
Mouse   153 IRACGCKSTVTPEMFKTMSNSEIIQHLTEEFNEDSGDYPLTAPGPSWKKFQGSFCEFVKTLVYQC 217

  Fly   220 QYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVALLVSNNFDNAAKQFEAE 284
            |||::||.|.||::||||.|||||||||||||:|||||||||:||.|||.:|.:.||..:|:|||
Mouse   218 QYSLLYDGFPMDDLISLLIGLSDSQVRAFRHTSTLAAMKLMTSLVKVALQLSLHKDNNQRQYEAE 282

  Fly   285 RVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDSLPDIRAICMAEIGIWM 349
            |.|..::||.:||:||:.||.|.:||.::|:.|:..:|:.||||||||.||:|||||:.|||.||
Mouse   283 RNKGPEQRAPERLESLLEKRKEFQENQEDIEGMMNAIFRGVFVHRYRDILPEIRAICIEEIGYWM 347

  Fly   350 ENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLELFTSKFKDRIVAMTLD 414
            ::|..:||:||||||||||||||..||||:|:::|..||...||..::||||::||||:|:|.:|
Mouse   348 QSYSTSFLNDSYLKYIGWTLHDKHKEVRLKCVKALAGLYSNQELSLRMELFTNRFKDRMVSMVMD 412

  Fly   415 KEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAEFLNVRLFH------LT 473
            :|.||:|.|::|:..|||....:|...|||.:|.:||.|:|.:|.:|.||:..::||      ..
Mouse   413 RECEVAVEAIRLLTLILKNMEGVLTSADCEKIYSIVYISNRAMASSAGEFVYWKIFHPECGAKAV 477

  Fly   474 ADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFID-SNDMVRDWECMTDLLLEE 537
            :|.|..::.:.:     ...:..|:.||:|||.|.|.||||||..| :...::|||.:|:|||::
Mouse   478 SDRERRRSPQAQ-----KTFIYLLLAFFMESEHHNHAAYLVDSLWDCAGSYLKDWESLTNLLLQK 537

  Fly   538 PGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDEKAKLTEHFIV 602
                ::.|.:.||..||||:|||.:|:|.|..||||.:.:| :|:|||.|....:|.||.||.|.
Mouse   538 ----DQNLGDMQERMLIEILVSSARQAAEGHPPVGRITGKK-SLTAKERKLQAYDKMKLAEHLIP 597

  Fly   603 TLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHTGREVLETCAK 667
            .||.||.|:.||:|.:|.||.:..||||::|.|.|.|.:|:.||.::.:|:..|...||||..|.
Mouse   598 LLPQLLAKFSADAENVAPLLQLLSYFDLSIYCTQRLEKHLELLLQQLQEVVVKHVEPEVLEAAAH 662

  Fly   668 TLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIYNITITLKVLSI 732
            .|..||......::|.:.|||.:::...::::..:::   |:|.... :||::|::|.|||.||.
Mouse   663 ALYLLCKPEFTFFSRVDFARSQLVDFLTDRFQQELDD---LMQSSFL-DEDEVYSLTATLKRLSA 723

  Fly   733 LYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNEALVYCIEACYFSISWGLQYVENECESVNV 797
            .|::|:|..||:.:...:.:.:|.....:    |::.::..:...||||.|.:.::.   ||.:.
Mouse   724 FYNAHDLTRWEISEPCSRLLRKAVDTGEV----PHQVILPALTLVYFSILWTVTHIS---ESTSH 781

  Fly   798 TEVVAELRNNLDTFMGACFELTRD-GPTVQIQEAAYQSICDLLIIFSDKLARSEIEHIRGLEYKS 861
            .:::: |:..:..|...|.....| .|  :|||.|:..:.|||:|||.::.....:.:|.|.:..
Mouse   782 KQLMS-LKKRMVAFCELCQSCLSDVDP--EIQEQAFVLLSDLLLIFSPQMIVGGRDFLRPLVFFP 843

  Fly   862 RMDEHLILDNFVQHYVFSLKQDVA-----QDETRIEELHKKRNFLACYCKLVVYNIIPTMRAASI 921
            .......|.:|:..:||....::.     :|..:||.||::|..||.:|||::|.::....|:.:
Mouse   844 EATLQSELASFLMDHVFLQPGELGNGQSQEDHVQIELLHQRRRLLAGFCKLLLYGVLELDAASDV 908

  Fly   922 FKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKSL-QEQSEDGIVSKSSQEFVDL 985
            ||:|.|.|.|||||||.||.:||:|::...:..|||||..::..| |||...|:....:  |:::
Mouse   909 FKHYNKFYEDYGDIIKETLTRARQIDRCQCSRILLLSLKQLYTELIQEQGPQGLTELPA--FIEM 971

  Fly   986 KELAKRFALTFGFDAIKNRESVAAIHRGGIYFAANK-EPDDPVRAPTRLLFLEVLNEFNYKLLKQ 1049
            ::||:||||:||...:.||:.|..:|:.||.|:.:: .|......|..|.|||:|:||:.:|..|
Mouse   972 RDLARRFALSFGPQQLHNRDLVVMLHKEGIKFSLSELPPAGSSHEPPNLAFLELLSEFSPRLFHQ 1036

  Fly  1050 DKKVIMSFLDKIIPPAMPSSRA--EEWQPLILYRNSLLHGE-TDQA-----PVASKRAYTRKRRD 1106
            ||::::|:|:|.:...   |:|  ..|.|:..|.:||...| |.:|     |.:.||......|.
Mouse  1037 DKRLLLSYLEKCLQRV---SKAPNHPWGPVTTYCHSLHPLEITAEASPRGPPHSKKRCVEGPCRP 1098

  Fly  1107 HDEEEEEEEDEEEHN 1121
            .:||...:|:..:.|
Mouse  1099 QEEESSSQEESLQLN 1113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 69/108 (64%)
Stag3NP_058660.2 IRR1 56..>426 CDD:227824 183/393 (47%)
STAG 188..296 CDD:285686 69/108 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62884119
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 901 1.000 Inparanoid score I372
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T616719
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.