DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and SA-2

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_612109.3 Gene:SA-2 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster

Alignment Length:1043 Identity:295/1044 (28%)
Similarity:489/1044 (47%) Gaps:124/1044 (12%)


  Fly    84 RKERVERPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSK--------NPIASIVDQWIEQYK 140
            |:|....|..|||      .:|......|:::.|..|:...:        :.|.|:...|.|.|.
  Fly    25 REECSIAPNDEPV------CVDGTVGDATNKSLLQMILSRKRLSPTNKRNSHIESVAKYWGEFYL 83

  Fly   141 ANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRK-- 203
            .:...|||||:||.:..||...:|.:|...|..::.|:...:..| ..:..||||      ||  
  Fly    84 DSPTAALVALLQFVVEVSGSHYQIPDDTSMPFSYSDILSNSSSHF-SNTHIYPLI------RKPA 141

  Fly   204 --FKNNFCDFVQTLVKQCQYSIIYDQFLMDN-------VISLLTGLSDSQVRAFRHTATLAAMKL 259
              |.|....|:..|:      ::.::|..|:       :.:.:...|:|.:|.||||||:..:|:
  Fly   142 DVFVNQVGSFLNALL------LVANKFRSDSYQLFLVQLTNFVMACSESNIRTFRHTATMIGLKI 200

  Fly   260 MTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEI-KSMLTYMFK 323
            ||.|.|                    :||.|                     ||| .::...||.
  Fly   201 MTILSD--------------------LKSLD---------------------DEIAMTVWMQMFN 224

  Fly   324 SVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRC-LQSLLPL 387
            |:||.|.||.:.|||.:|::|:|.|...||...|..:.|:.....|:|..|:| ::| |.::..|
  Fly   225 SMFVARSRDIVTDIRLLCISELGQWFARYPHCHLQPTSLRIFYEALNDGSGDV-IQCSLDNISVL 288

  Fly   388 YEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYS 452
            ..||.|..::...||:|::.:|.:.|.||..::..:|:.:.....:..|||.|..|.::.:|:.:
  Fly   289 CRKDVLFSEIVALTSEFREILVELCLGKEDAIAEKSVQFLTHFHVLSAEILTDDVCRVLEQLIMA 353

  Fly   453 SHRGVAQAAAEFLNVRLFHLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSF 517
            ::||:|||||:...:|...|..   ||..:|          |:.|:|.|||.. ||...|||||.
  Fly   354 ANRGLAQAAADLFILRRNGLDG---ETFCQR----------VKHLLQLFIECG-HEQADYLVDSL 404

  Fly   518 IDSNDMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLS 582
            ||:.::|.||:.|..:|||.|...|  |.:...|:||.|:::.|||:..||:|.||.:       
  Fly   405 IDNCELVLDWKSMIAVLLENPKSRE--LSDIHCSSLIAILLAGVKQATAGEIPPGRYT------- 460

  Fly   583 AKELK--AIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQAL 645
             |:||  ..|..:.:.|:.....||.||..|....:.:..||.:|:||..:.|....:.|.|..|
  Fly   461 -KDLKREPRQGAQERATKCLAPVLPELLRTYANRLQDIERLLELPKYFCFDYYHEQNRMGQLNEL 524

  Fly   646 LDRINQVMSMHT-GREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLI 709
            ::....::...| ...||:...||||.|........|:      .::.|||..||.|....::..
  Fly   525 VEHFELIIFDQTSSTTVLQITVKTLEFLNRMIPIPLTK------QLLNSAVTNYKMAWHRTQDTS 583

  Fly   710 QGEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDR--CLPNEALVY 772
            ....|.||.:  .:..||::|::|....||:.|:|.:.|...::....:..:..  .||.||...
  Fly   584 PSRSTHNESN--RLLATLRLLTVLSGHFNLSKWDLTEPLLFSLKMLLRQRRLPNGDDLPPEAFSL 646

  Fly   773 CIEACYFSISWGLQYVENEC-ESVNVTEVVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQSIC 836
            .::||:..:.|.::.:|... .:|::.|....|.:||:.::...|.|.....|..:....:...|
  Fly   647 YLKACFCCLCWDMENLEGTALNNVDMDEYCDVLHHNLEDYLYVTFSLVGKSNTEPLAYPCFSYTC 711

  Fly   837 DLLIIFSDKLARSEIEHIRGLEYKSRMDEHLILDNFVQHYVFSLKQDVAQDETRIEELHKKRNFL 901
            ||.::..: |..|....||.:.:....:|..||:.|:..:...|.......||..::|.:.|:.|
  Fly   712 DLFVLHGN-LCGSSNPSIRSVAHVPSGNELDILEGFLMEHFLELSPSDLMLETNSDQLQRIRSIL 775

  Fly   902 ACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVF-KS 965
            ..|.|:|...::|||||:..::||||.:..:||:::.::..|.:.|.::||||:|.:.:.:: |.
  Fly   776 TSYLKVVCLGVVPTMRASKFYEYYVKYHAPFGDVMRCSMELALQRNPIHFAMTMLHTCLLLYAKV 840

  Fly   966 LQEQSEDGIVSKSSQ--EFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFAANKEPDDPVR 1028
            ..:.:......::.:  ||.:|.|||.|.|.....:.:::||.|.|:||.||.|........|..
  Fly   841 FPDDTRHAAGQRALRPAEFSELMELANRLAKILISNPMEHRECVIALHRSGILFVFELAQKQPTE 905

  Fly  1029 APTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLLHGETDQAP 1093
            |..:|.||.||..|...||.|||..|::|.:......:|:....:...|..|||:|...:|...|
  Fly   906 ATKKLPFLRVLKVFVPLLLVQDKTRILNFFEPYEQLIIPTCNRNDIAHLKEYRNALRPRKTKSYP 970

  Fly  1094 VAS 1096
            .|:
  Fly   971 QAT 973

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 29/119 (24%)
SA-2NP_612109.3 STAG 134..217 CDD:285686 32/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59626328
eggNOG 1 0.900 E1_COG5537
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11199
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.