DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and TRIM74

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_001304744.1 Gene:TRIM74 HGNCID:17453 Length:250 Species:Homo sapiens

Alignment Length:95 Identity:22/96 (23%)
Similarity:40/96 (42%) Gaps:20/96 (21%)


  Fly   548 KQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLS------AKELK-AIQDEKAKL-------TE 598
            |||...::.:::.:.::.|      |..|.....|      .:||: .:.:|||:.       |.
Human   144 KQEQKKVDELIAKLVKNRT------RIVNESDVFSWVIRREFQELRHPVDEEKARCLEGIGGHTR 202

  Fly   599 HFIVTLPSLLEKYQADSEKLANLLAVPQYF 628
            ..:.:|...||:.|...|:||....|.:.|
Human   203 GLVASLDMQLEQAQGTRERLAQAECVLEQF 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686
TRIM74NP_001304744.1 RING 15..60 CDD:238093
BBOX 90..125 CDD:237988
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.