DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and Stag1

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_006243693.1 Gene:Stag1 RGDID:1310744 Length:1258 Species:Rattus norvegicus

Alignment Length:1186 Identity:520/1187 (44%)
Similarity:736/1187 (62%) Gaps:135/1187 (11%)


  Fly    25 DALNESTSDADSPTK------RMTRLRARGGVRDKPPIIDDDEDDFFAPIARKRKTPATRKGPTE 83
            |:.||:|:.:|:.::      :..|.|.|.|   :||              ...|.|  ||.|.|
  Rat    11 DSTNETTAHSDAGSELEETEVKGKRKRGRPG---RPP--------------STNKKP--RKSPGE 56

  Fly    84 RKERVE---------RPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQY 139
             |.|:|         |....|...|..:.:           :|:.:|:..|:.:.|:||.|||.|
  Rat    57 -KSRIEAGIRGVGRGRANGHPQQNGEGDPV-----------TLFEVVKLGKSAMQSVVDDWIESY 109

  Fly   140 KANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRKF 204
            |.:|:.||:.|:.|||..|||:|.:..::...:.:..|||:|||||||:||:|||.|.|.||:||
  Rat   110 KQDRDIALLDLINFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKF 174

  Fly   205 KNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVALL 269
            ::|||:|:..|::|||||||||:::||.|||||||||||||||||||:||||||||||||:|||.
  Rat   175 RSNFCEFIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALN 239

  Fly   270 VSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDSL 334
            :|.:.||..:|:||||.|...:||::||:.|:.||.||:||.|||::|:..:||.:|||||||::
  Rat   240 LSIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRYRDAI 304

  Fly   335 PDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLEL 399
            .:|||||:.|||:||:.|...||:||||||:||||||:.|||||:||::|..||...||..||||
  Rat   305 AEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTNRELFPKLEL 369

  Fly   400 FTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAEF 464
            ||::||||||:||||||::|:|.|::||..||....|.|:::|||.||.||||:||.||.||.||
  Rat   370 FTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLVYSAHRPVAVAAGEF 434

  Fly   465 LNVRLF--HLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFIDSN-DMVRD 526
            |:.:||  | ....||...||.....||..|:|.||.||:|||||||.||||||..:|: ::::|
  Rat   435 LHKKLFSRH-DPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKD 498

  Fly   527 WECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQD 591
            |||||:||||||...||.:.::|||.|||:||.:::|:|....||||.:.:: .|:|||.|...|
  Rat   499 WECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAHPPVGRGTGKR-VLTAKERKTQID 562

  Fly   592 EKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMH 656
            ::.|||||||:|||.||.||.||:||:||||.:||||||.:|:|.|.|.:|.|||.:|..|:..|
  Rat   563 DRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKH 627

  Fly   657 TGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIY 721
            ...:|||.|:||...||:|......|.:||||.:|:..|:::..::|:   |:|..|..::||||
  Rat   628 VESDVLEACSKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVED---LLQEGEEADDDDIY 689

  Fly   722 NITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDR-CLPNEALVYCIEACYFSISWGL 785
            |:..|||.|:..:::|:|..|:||.:.::.:     |..|:. .:|.:.:|..::..::||.|.|
  Rat   690 NVLSTLKRLTSFHNAHDLTKWDLFGNCYRLL-----KTGIEHGAMPEQIVVQALQCSHYSILWQL 749

  Fly   786 QYVENECESVNVTEVVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSE 850
            ..:.:...|   .|.:..||..:.:|:..|.:...:..| .::|.|:..:||||:|||.:|....
  Rat   750 VKITDGSPS---KEDLLVLRKTVKSFLAVCQQCLSNVNT-PVKEQAFMLLCDLLMIFSHQLMTGG 810

  Fly   851 IEHIRGLEYKSRMDEHLILDNFVQHYVF--------SLKQDVAQDETRIEELHKKRNFLACYCKL 907
            .|.::.|.:.........|.:||..:||        |::.|...:..:||.|||:||.||.:.||
  Rat   811 REGLQPLVFNPDTGLQSELLSFVMDHVFIDQDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKL 875

  Fly   908 VVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKSL-QEQSE 971
            ::|:|:....||.|||:|:|.|||||||||.||.|.|:|:|:..|.||:|||..:|..| |||..
  Rat   876 IIYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGP 940

  Fly   972 DGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFA----ANKEPDDPVRAPTR 1032
            :  :.::|.....:||||:|||||||.|.||.||:||.:|:.||.||    ..|..:.|   |..
  Rat   941 N--LDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYP---PPN 1000

  Fly  1033 LLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLL-HGETDQAPV-- 1094
            |.|||||:||:.|||:||||.:.|:|:|.:...|...|.:.|.|||.|||||: .||.|:..|  
  Rat  1001 LAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNS 1065

  Fly  1095 ---ASKRAYTR---------KRRDHDEE------------------------------------- 1110
               :||.:..|         ::|..||.                                     
  Rat  1066 GSSSSKTSSVRSKKGRPPLHRKRAEDESLDNTWLNRTDTMIQTPGPLPTPQLTSTVLRENSRPMG 1130

  Fly  1111 EEEEEDEEEH-NDPDY 1125
            |:.:|.|.|| ::||:
  Rat  1131 EQIQEPESEHGSEPDF 1146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 73/108 (68%)
Stag1XP_006243693.1 RFX5_DNA_bdg 3..>58 CDD:291295 18/67 (27%)
STAG 160..268 CDD:285686 73/108 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62834643
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 1 1.000 H21191
Inparanoid 1 1.050 890 1.000 Inparanoid score I360
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T618841
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11199
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.