DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and Stag2

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_006257565.1 Gene:Stag2 RGDID:1562042 Length:1268 Species:Rattus norvegicus

Alignment Length:1062 Identity:492/1063 (46%)
Similarity:699/1063 (66%) Gaps:59/1063 (6%)


  Fly    78 RKGPTERKERVERPRKEPVD----KGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQ 138
            :|||.|:.:......|.|..    .|||::...|..:      |:.:|:..|:.:.|:||.|||.
  Rat    47 KKGPAEKGKSGNGGGKPPSGPNRMNGHHQQNGVENMM------LFEVVKMGKSAMQSVVDDWIES 105

  Fly   139 YKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRK 203
            ||.:|:.||:.|:.|||..|||||.::.::...:.::.|||:|||||||:||:|||.|:|.||:|
  Rat   106 YKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKK 170

  Fly   204 FKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVAL 268
            ||::||:|:..||:|||||||||:::||.|||||||||||||||||||:||||||||||||:|||
  Rat   171 FKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVAL 235

  Fly   269 LVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDS 333
            .:|.|.||..:|:||||.|...:||::||:.|:.||.||:||.|||::|:..:||.||||||||:
  Rat   236 NLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDA 300

  Fly   334 LPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLE 398
            :.:|||||:.||||||:.|...||:||||||:|||:|||.|||||:||.:|..||...||..|||
  Rat   301 IAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELNSKLE 365

  Fly   399 LFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAE 463
            ||||:||||||:||||||::|:|.|:||:..:|:...|:|..:|||.||.||||:||.||.||.|
  Rat   366 LFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSAHRPVAVAAGE 430

  Fly   464 FLNVRLFHLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFID-SNDMVRDW 527
            ||..:||......|:...||...:.||..||:.||.||:|||||||.||||||..| :.::::||
  Rat   431 FLYKKLFSRRDPEEDGIMKRRGRQGPNANLVKTLVFFFLESELHEHAAYLVDSMWDCATELLKDW 495

  Fly   528 ECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDE 592
            |||..||||||...||.|.::|||.|||||:.:::|:|....||||.:.:: .|:|||.|...|:
  Rat   496 ECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKR-VLTAKEKKTQLDD 559

  Fly   593 KAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHT 657
            :.::||.|.|.||.||.||..|:||:.|||.:||||||.:|||.|.|.:|.|||.:|..::..||
  Rat   560 RTRITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHT 624

  Fly   658 GREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIYN 722
            ..:|||.|:||...||.|....:.|.:|:||.:|:...:|:...:|::  |.:||| |:|||.|.
  Rat   625 DTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDF--LQEGEE-PDEDDAYQ 686

  Fly   723 ITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNEALVYCIEACYFSISWGLQY 787
            :..|||.::..:::|:|:.|:||...::.::  ...||.|  :|.:.:::.::..::.|.|.|..
  Rat   687 VLSTLKRITAFHNAHDLSKWDLFACNYKLLK--TGIENGD--MPEQIVIHALQCAHYVILWQLAK 747

  Fly   788 VENECESVNVTEVVAELRNNLDTFMGAC-FELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSEI 851
            :   .||.:..|.:..|:..:..|...| ..||....||  :|.|:..:||:|:|||.::.....
  Rat   748 I---TESTSTKEDLLRLKKQMRVFCQICQHYLTNVNTTV--KEQAFTILCDILMIFSHQIMSGGR 807

  Fly   852 EHIRGLEY--KSRMDEHLILDNFVQHYVFSLKQD--------VAQDE-TRIEELHKKRNFLACYC 905
            :.:..|.|  .|.:...|:  :|:..:|| ::||        ..:|| ::||.|||:||.||.:|
  Rat   808 DMLEPLVYTPDSSLQSELL--SFILDHVF-IEQDDDSNSADGQQEDEASKIEALHKRRNLLAAFC 869

  Fly   906 KLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKSLQEQS 970
            ||:||.::....||.|||.|:|.|||||||||.|:.|.|:|:|:..|.||:|||..:|..:.:  
  Rat   870 KLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQ-- 932

  Fly   971 EDGI-VSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFAANKEPDDPVRA--PTR 1032
            |:|. ..:||..|..:||||:|||||||.|.:|.||::|.:|:.||.||. |||:....:  |..
  Rat   933 ENGYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEFAF-KEPNPQGESHPPLN 996

  Fly  1033 LLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLLHGETDQ------ 1091
            |.||::|:||:.|||:|||:.:..:|:|.:...|...|.:.|.||:.||||||.|..|.      
  Rat   997 LAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVIS 1061

  Fly  1092 ------APVASKRA--YTRKRR 1105
                  :.|.||::  .|.||:
  Rat  1062 GMSSRGSTVRSKKSKPSTGKRK 1083

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 75/108 (69%)
Stag2XP_006257565.1 NADB_Rossmann <116..>145 CDD:304358 10/29 (34%)
STAG 157..265 CDD:285686 75/108 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62879396
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 890 1.000 Inparanoid score I360
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T618841
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 LDO PTHR11199
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.