DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and psc3

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_001343016.1 Gene:psc3 PomBaseID:SPAC17H9.20 Length:962 Species:Schizosaccharomyces pombe

Alignment Length:856 Identity:192/857 (22%)
Similarity:341/857 (40%) Gaps:189/857 (22%)


  Fly    48 GGVRDKPPII-----------------DDDEDDFFAPIARKRKTPATRKGPTERKERVERPRKEP 95
            ||.|:..|::                 ::.:||:...|:.|::.|.    |..:...|:|.|:..
pombe    13 GGDRESSPVMLSQSFDPMSSSSNSSSEENSDDDYEKTISSKKRHPR----PNSKGVNVKRSRRNA 73

  Fly    96 VDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQYKANRETALVALMQFFINASGC 160
            :.:.     |.:.||.   |:|:..:...|.....|...|...|..:.::||..|:.|.:...||
pombe    74 IVEE-----DPQEEIF---NNLFAFLLDQKVDTMDIAVSWFADYAKDNQSALANLINFILKCCGC 130

  Fly   161 KGKIS--------------EDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRKFKNNFCDF 211
            ...|:              ..||..|:.||            :.:|||.....::|.|:......
pombe   131 NRAINVFDVQDQDSASATLSQIQLSVERTS------------TRDYPLNSKNLKFRNFRKRLTGL 183

  Fly   212 VQTLVKQCQY-SIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVALLVSNNFD 275
            :...|.|... :.:|:..:.::::|.:..:|.|.:|..|||||:..:.:||.|.:.:..:.|...
pombe   184 LSNFVSQLSIRNYLYNSTVFEDIMSWVVAMSSSTMRPIRHTATVFCLNIMTFLCEKSKELLNEHA 248

  Fly   276 NAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDSLPDIRAI 340
            .|.||.|.|..:||..|  :|::.|.....|:.:..|.:.:.|...|.|||||||||..|.||..
pombe   249 IATKQLEKEEKRSRVNR--NRINELNNSLGEIVKQQDTLTTYLNDYFDSVFVHRYRDVEPKIRVD 311

  Fly   341 CMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLELFTSKFK 405
            |:.|:|:|:...|..|...|||:|:||.|.|....|||..::.|...:|.|...|.|..|:|:||
pombe   312 CLQELGVWINTVPSIFFSGSYLRYLGWMLSDINTTVRLTVVKVLRKFFETDSFIGGLRHFSSRFK 376

  Fly   406 DRIVAMT-LDKEFEVSVHAVKL--------------VISILK----IHPEILADKD---CEIVYE 448
            :||:.|: :|.:..|.|.:::|              ::.:||    |:|.:..:..   |::|.|
pombe   377 ERILEMSCVDADIGVRVASIRLCNAMRTCGFLENSEILKVLKLILDINPRVQREAVLFLCKVVDE 441

  Fly   449 LV------------------------YSSH-RGVAQAAAEFLNVRLFHLTADMEETK----TKRG 484
            .|                        :|.| ...:|.......|||.:.::...:|.    .|.|
pombe   442 SVNEKIDLWGEEDYILKAFSQTSLTTFSVHWIKFSQMCKLLEEVRLSYQSSFDYDTLLRIFQKNG 506

  Fly   485 KVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFIDSNDMVRDWECMTDLLLEE------PGPNEE 543
            ..   .||:.:.|:           .|..:||...|      ||.:::.:|.:      ..|.:.
pombe   507 NF---ITPITQALL-----------NACEIDSIYQS------WEDISNFVLFDNYTSTLKDPIDS 551

  Fly   544 V-----LDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDEKAKLTEHFIVT 603
            :     |::.|||.|::::.:|::..........:..:.|   .|.|....|::...|.  ::..
pombe   552 ILSFCKLNDFQESILLQLLSASIQTVCNNNFITPKTVHNK---QAAETTNDQNKDKDLL--YLNL 611

  Fly   604 LP---SLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHTGREVLETC 665
            ||   |:.|:..|....|.:.|.:....||...|..:...:.:.|::.:.:....:...::::.|
pombe   612 LPYINSITERNSASPTLLHDSLRLLFSMDLTEMTDPQLSRHFELLINNLKKFFLTNNDLQIIQGC 676

  Fly   666 A----------------KTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAI-EEWRNLIQG-- 711
            .                |.|.....:.:.|....|....||.::.:.|.:..| |.....|:|  
pombe   677 TILFLRLDSIPALKEDLKLLVTDICDQTVTEFLKNFGSFNIQDAVITKDEFVIFEACLTRIEGCT 741

  Fly   712 -----EETPNEDDIYNITI------------TLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKE 759
                 .:.|..|.||...:            ||| .|.:.:..:|..| .|.......:|.:.|:
pombe   742 SLKDFSDYPEFDIIYERLVSLLSRVPNSYEDTLK-FSAINTLQSLLFW-FFLRKDNPADEEKKKD 804

  Fly   760 N---IDRCLPN 767
            :   :..||.|
pombe   805 DETKVFNCLIN 815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 30/109 (28%)
psc3NP_001343016.1 STAG 1..724 CDD:331549 171/762 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T1125450
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 LDO PTHR11199
Phylome 1 0.910 0.950 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.