DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and rec11

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_588108.3 Gene:rec11 PomBaseID:SPCC4E9.01c Length:923 Species:Schizosaccharomyces pombe

Alignment Length:950 Identity:169/950 (18%)
Similarity:329/950 (35%) Gaps:252/950 (27%)


  Fly    21 ELHSDA---LNESTSDADS----------PTKRMTRLRARGGVRDKPPIIDDDEDDFFAPIARKR 72
            |..|||   |||..::.:|          |:.:...:.|                   :|..:||
pombe     4 EFESDASSHLNEVLTELESVELENVEYEGPSLQNVSICA-------------------SPSEKKR 49

  Fly    73 KTPATRK-GPTERKERVERPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWI 136
            |.....: ..||.:|..|....|.:....|:....:        ..:..:.....|:..:...:.
pombe    50 KWGTQDEFSLTENEENNEIETNEEMHVNSHDYAFPQ--------EFFLKLLDIDMPLEQLSQHYF 106

  Fly   137 EQYKANRETALVALMQFFINASGCKGKISE-DIQYPVDHTSIIRRMTE----EFDEESGEYPLIM 196
            |.||:|....::..:.|.:.||||:..::. |:|   |..||...:::    .|.:.|..|...:
pombe   107 EDYKSNSADFMLTFINFALVASGCQPFVTNFDVQ---DVDSIPETLSQVNRSSFQKSSCAYTDYL 168

  Fly   197 SGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFL----MDNVISLLTGLSDSQVRAFRHTATLAAM 257
            ..:..::.|.....|...||:......:.|.||    |:...:.:..::.|.....|||||....
pombe   169 YTSNSKEAKTVRIRFQLFLVEFISKVYVEDAFLGDSFMETTKAWIFTMTTSPWMLVRHTATTICC 233

  Fly   258 KLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMF 322
            .:|..|    .|:.|.....:.| .||.:..||          :|.|         ...|:..:.
pombe   234 DIMRCL----CLIVNKLSEKSNQ-TAEILVLRD----------LTSR---------FIDMIHDIC 274

  Fly   323 KSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSL--L 385
            .||...|..|....||.:|:..:....:..|...::.:.:::.||.|.|...::|...|:.:  |
pombe   275 DSVLFSRIHDIRASIRIVCVTALYDCCQLLPTYLINRNLIRHSGWGLSDAESQIRKISLKIIDYL 339

  Fly   386 PLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEV-SVHAVKLVISILKIHPEILADKDC-EIVYE 448
            ..:|.::.:..:..|..:|..|||.:.   .::: ||.:|.|. :..|:..:|..:..| .||..
pombe   340 SSHEPEKDQDFVVDFLDRFSLRIVEIC---RYDIDSVRSVALK-TCEKLMEKISLNGKCINIVSS 400

  Fly   449 LVYSSHRGVAQAAAEFLNVRLFHLT---ADMEETKT---------KRGKVRMPNTPLV------- 494
            .::.   |..|.....:.:.:.|..   |:..|.||         :|.|:     ||:       
pombe   401 CIFD---GKPQNRISTMRILVAHTNERYANYCEAKTATISLSKLLRREKI-----PLLVSSFESL 457

  Fly   495 ------------------RDL-------------------------VQFFIESELHEHGAYLVDS 516
                              ||.                         ..|..|.:::.|...|::.
pombe   458 FKMNALLFILEQGFESWFRDSSDHIFSRVKDDDKFVYQSQENNFYDADFIREYDMNNHRQQLIEE 522

  Fly   517 FIDS----NDMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNR 577
            .:.|    :.::..||.:..|||.:.      .|.|..::::...:.|........:.:...:..
pombe   523 SMHSIHTNSQLLASWEDVAKLLLYDR------FDAKDTNSVLNPCIPSNAVIEFSSIYLHYFATH 581

  Fly   578 KCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNL 642
            ....|.|..|.::||.....:..:..||.||:||:..        .|..||.:..         :
pombe   582 ISKRSKKPGKRLEDEVVNQQQAMLRNLPLLLQKYRES--------CVSSYFFIKC---------V 629

  Fly   643 QALLDRINQVMSMHTG-----REVLE----TCAKTLECLCAEGSATYTRCNIARSNIIESAVNKY 698
            :.:.|.:......|..     :|:|:    |....|..||:..........:.:.:|:.:..|.|
pombe   630 EQIPDELLYKREFHKDFSKLYKEILDIFNSTTVNFLMILCSRFFHRLAVNKVVQEDILFAIDNVY 694

  Fly   699 KDAIEEW---------------RNLIQG-EETPN-------------------EDDIYNITI--- 725
            .|..|..               :|.:.| :||.|                   :.:.:||.:   
pombe   695 NDLAESLHEQLNAYIQRKKINKKNQLNGNDETQNLVLALNKFGCFAKEMVCLRDVNDWNIKLSEK 759

  Fly   726 ----------------TLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNEALVYCI 774
                            :||||.:|..|...:...:|.::|....:...::|.:..|....:...:
pombe   760 LCEICSLEVGPIVCYSSLKVLFLLLLSDMRDRNCIFTNIFLKAAKVAKQKNGNSFLSKVFITITM 824

  Fly   775 EACYF---SISWGLQYVENECESVNVTEVVAELRNNLDTF 811
            ...:.   :.:|.:.:.:::.:.:|..|::.:    ::||
pombe   825 LTLFLGSKANNWDINFSDDDLKLMNEEEIMEQ----IETF 860

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 24/112 (21%)
rec11NP_588108.3 IRR1 2..766 CDD:227824 154/851 (18%)
STAG 165..253 CDD:285686 19/93 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.