DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and Stag1

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_033308.2 Gene:Stag1 MGIID:1098658 Length:1258 Species:Mus musculus

Alignment Length:1185 Identity:516/1186 (44%)
Similarity:738/1186 (62%) Gaps:133/1186 (11%)


  Fly    25 DALNESTSDADSPTKRMTRLRARGGVRDKPPIIDDDEDDFFAPIARKRKTPATRKGPTERKERVE 89
            |:.||:|:.:|:.::                 :::.|      :..|||.....:.|:..|    
Mouse    11 DSTNETTAHSDAGSE-----------------LEETE------VKGKRKRGRPGRPPSTNK---- 48

  Fly    90 RPRKEPVDKGHHERIDS--------------EREITTDENSLYYIVRHSKNPIASIVDQWIEQYK 140
            :|||.|   |...||::              ::....|..:|:.:|:..|:.:.|:||.|||.||
Mouse    49 KPRKSP---GEKSRIEAGIRGAGRGRANGHPQQNGDGDPVTLFEVVKLGKSAMQSVVDDWIELYK 110

  Fly   141 ANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRKFK 205
            .:|:.||:.|:.|||..|||:|.:..::...:.:..|||:|||||||:||:|||.|.|.||:||:
Mouse   111 QDRDIALLDLINFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFR 175

  Fly   206 NNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVALLV 270
            :|||:|:..|::|||||||||:::||.|||||||||||||||||||:||||||||||||:|||.:
Mouse   176 SNFCEFIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNL 240

  Fly   271 SNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDSLP 335
            |.:.||..:|:||||.|...:||::||:.|:.||.||:||.|||::|:..:||.:|||||||::.
Mouse   241 SIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRYRDAIA 305

  Fly   336 DIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLELF 400
            :|||||:.|||:||:.|...||:||||||:||||||:.|||||:||::|..||...||..|||||
Mouse   306 EIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTNRELFPKLELF 370

  Fly   401 TSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAEFL 465
            |::||||||:||||||::|:|.|::||..||....|.|:::|||.||.||||:||.||.||.|||
Mouse   371 TNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLVYSAHRPVAVAAGEFL 435

  Fly   466 NVRLF--HLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFIDSN-DMVRDW 527
            :.:||  | ....||...||.....||..|:|.||.||:|||||||.||||||..:|: ::::||
Mouse   436 HKKLFSRH-DPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKDW 499

  Fly   528 ECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDE 592
            ||||:||||||...||.:.::|||.|||:||.:::|:|....||||.:.:: .|:|||.|...|:
Mouse   500 ECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAHPPVGRGTGKR-VLTAKERKTQIDD 563

  Fly   593 KAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHT 657
            :.|||||||:|||.||.||.||:||:||||.:||||||.:|:|.|.|.:|.|||.:|..|:..|.
Mouse   564 RNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHV 628

  Fly   658 GREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIYN 722
            ..:|||.|:||...||:|......|.:||||.:|:..|:::..::|:   |:|..|..::|||||
Mouse   629 ESDVLEACSKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVED---LLQEGEEADDDDIYN 690

  Fly   723 ITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDR-CLPNEALVYCIEACYFSISWGLQ 786
            :..|||.|:..:::|:|..|:||.:.::.:     |..|:. .:|.:.:|..::..::||.|.|.
Mouse   691 VLSTLKRLTSFHNAHDLTKWDLFGNCYRLL-----KTGIEHGAMPEQIVVQALQCSHYSILWQLV 750

  Fly   787 YVENECESVNVTEVVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSEI 851
            .:.:...|   .|.:..||..:.:|:..|.:...:..| .::|.|:..:||||:|||.:|.....
Mouse   751 KITDGSPS---KEDLLVLRKTVKSFLAVCQQCLSNVNT-PVKEQAFMLLCDLLMIFSHQLMTGGR 811

  Fly   852 EHIRGLEYKSRMDEHLILDNFVQHYVF--------SLKQDVAQDETRIEELHKKRNFLACYCKLV 908
            |.::.|.:.........|.:||..:||        |::.|...:..:||.|||:||.||.:.||:
Mouse   812 EGLQPLVFNPDTGLQSELLSFVMDHVFIDQDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLI 876

  Fly   909 VYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKSL-QEQSED 972
            :|:|:....||.|||:|:|.|||||||||.||.|.|:|:|:..|.||:|||..:|..| |||..:
Mouse   877 IYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPN 941

  Fly   973 GIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFA----ANKEPDDPVRAPTRL 1033
              :.::|.....:||||:|||||||.|.||.||:||.:|:.||.||    ..|..:.|   |..|
Mouse   942 --LDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYP---PPNL 1001

  Fly  1034 LFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLL-HGETDQAPV--- 1094
            .|||||:||:.|||:||||.:.|:|:|.:...|...|.:.|.|||.|||||: .||.|:..|   
Mouse  1002 AFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSG 1066

  Fly  1095 --ASKRAYTR---------KRRDHDEE-------------------------------------E 1111
              :||.:..|         ::|..||.                                     |
Mouse  1067 SSSSKTSSVRSKKGRPPLHRKRVEDESLDNTWLNRTDTMIQTPGPLPTPQLTSTVLRENSRPMGE 1131

  Fly  1112 EEEEDEEEH-NDPDY 1125
            :.:|.|.|| ::||:
Mouse  1132 QIQEPESEHGSEPDF 1146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 73/108 (68%)
Stag1NP_033308.2 RFX5_DNA_bdg 3..>58 CDD:291295 16/77 (21%)
IRR1 12..>398 CDD:227824 204/416 (49%)
STAG 160..268 CDD:285686 73/108 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62873007
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 1 1.000 H21191
Inparanoid 1 1.050 901 1.000 Inparanoid score I372
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T616719
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.