DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and scc-3

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_506193.1 Gene:scc-3 WormBaseID:WBGene00004738 Length:1096 Species:Caenorhabditis elegans

Alignment Length:1130 Identity:381/1131 (34%)
Similarity:615/1131 (54%) Gaps:117/1131 (10%)


  Fly    27 LNESTSDADSPTKRMTRLRARGGVRD---------KPPIIDDDEDDFFAPIARKRKTPATRKGPT 82
            ::|:.:| .||.:..||.:||....|         |.|:.              |...|:.:|..
 Worm     1 MSETPTD-QSPQRMSTRNQARVNYTDMAAGNNSVEKEPVF--------------RSPTASTRGRK 50

  Fly    83 ERKERVE---------------------RPRKEPVDKGHHERIDSEREITTDENS------LYYI 120
            :|...|:                     |||...:......|....|..||:|::      |...
 Worm    51 KRAANVDVADLSASFGNLNNFSTPPKRGRPRGGGLGSARGGRAPMVRRTTTEESAEVDDRELVAA 115

  Fly   121 VRHSKNPIASIVDQWIEQYKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEF 185
            |:..|. |...||:||.:|......|:..:.|||....||||.::..:...:.:..||.||||:|
 Worm   116 VKSGKK-ITEAVDRWIGRYNEKFLVAIAEMHQFFFAICGCKGIVTPQMSATLTYKDIICRMTEDF 179

  Fly   186 DEESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRH 250
            :|:|.:|||:..|: .:|.:.|..:|:.||:.:.:.|:::|..|||..:.||||::|||||||||
 Worm   180 EEDSADYPLVHGGS-LKKVRANLHNFIHTLIIRTKASMLFDSNLMDGFVQLLTGMADSQVRAFRH 243

  Fly   251 TATLAAMKLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRA-SDRLDSLMTKRSELEENMDEI 314
            |||..|||:.:|||||.:.::.:.:..:||.|||:.|.::..| :::.::|:.:|::.||..:||
 Worm   244 TATFCAMKITSALVDVTIELTQSKEKTSKQIEAEKAKLKNNSAGNEKYEALVAQRTQTEERAEEI 308

  Fly   315 KSMLTYMFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLR 379
            :.::.|:|:|||||||||.:||||.||:.|:|.||:.||::|::|||||||||::.||:|:||.|
 Worm   309 RQIIGYLFRSVFVHRYRDVVPDIRCICIQELGHWMDVYPEHFVEDSYLKYIGWSMFDKVGDVRQR 373

  Fly   380 CLQSLLPLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCE 444
            |:::|:||:||..:..|||||.:|||||:|:|.|||:.|.|:..|.|:..:..:.|.:|..||..
 Worm   374 CIRALIPLFEKTLILDKLELFVNKFKDRLVSMLLDKDLETSIETVHLMRVLYTVFPTLLTIKDVV 438

  Fly   445 IVYELVYSSHRGVAQAAAEFLNVRLFHLTADMEETKTKRGKV-RMPNTPLVRDLVQFFIESELHE 508
            .:|||:|:|:|.:|.||..|||.::|       .:..|.||. ...|.|||:||..||||.:||:
 Worm   439 PIYELIYASNRPLAVAAGMFLNTKVF-------RSAEKPGKAPTAANIPLVKDLTTFFIEGDLHQ 496

  Fly   509 HGAYLVDSFIDSNDMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGR 573
            |..||||:..:||.:|:||..|.:||:.:    :..||:..|:.||||:..||.||||||.||||
 Worm   497 HATYLVDALFESNPIVKDWATMGELLIND----QYQLDSNFETKLIEILTCSVVQSATGEPPVGR 557

  Fly   574 ASNRKCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQ 638
            ...:|...||||.:.:.:::.:|||..|..:|.|:.|:.:|:||:.||:.:|.:|.|..|.:.|.
 Worm   558 HIVKKGAPSAKESRDLVEDRQRLTETLIPLIPRLITKFSSDNEKIINLVNIPLHFQLETYLSARM 622

  Fly   639 EGNLQALLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIE 703
            :.:|..|::.::.::..|...|:|:..|:....|....|.         |.::|....|..|.:.
 Worm   623 QTHLMELMEGLDSLIEKHLDEELLKAVAELYYHLTTNSSI---------SALVEGHKMKLLDGVA 678

  Fly   704 EW-RNLIQ-------GEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKEN 760
            .: |..:|       |||   |:.::  ...:|.::......:|..|:|:..|.:.|.. .::|:
 Worm   679 AFIRKSMQQFDDDQMGEE---EEALF--VSYIKRMAAFAGFMDLRHWDLWDILLKVVSN-YTRED 737

  Fly   761 IDRCLPNEAL-VYCIEACYFSISWGLQYVENECESVNVTEVVAELRNNLDTFMGACFE-LTRDGP 823
            ..|.:...:: :..::.|:.|::     ::.|.|:....: |.:|:...|..:....| |..:..
 Worm   738 TQRDVRERSMQMLFMQLCFDSMN-----IKKEGETPKADQ-VRKLKKRRDQLIRIVTETLNEEAC 796

  Fly   824 TVQIQEAAYQSICDLLIIFSDKLARSEIEHIRGLEYKSRMDEHLILDN---FVQHYVFSLK--QD 883
            .|   |.||..||||:|:|..:||    |..:.||......:.::|.|   |:...||.:.  .|
 Worm   797 GV---EQAYLVICDLMILFGSQLA----EESKALEPLIWRPDAMVLGNLKIFLDVNVFDVSNLDD 854

  Fly   884 VAQDETRIEELHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINK 948
            :.|.| :||.:||.|..:|.|.||:::..:|...|:.:.|.|...:.|:|||.|..|.|.|||:.
 Worm   855 MDQQE-KIEVMHKMRQHVAQYAKLIIHGAMPVAEASHLIKRYQSHFQDFGDIFKNLLSKCREISF 918

  Fly   949 VNFAMTLLLSLITVFKSLQE-QSEDGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHR 1012
            |...:.:..:|.|::..|.| |..|.:    |:.|..:::||||....||.|..|||.:::::|:
 Worm   919 VETGVMICETLKTLYSQLDEDQGTDPL----SESFNSIRDLAKRLGPAFGVDYAKNRFAISSLHK 979

  Fly  1013 GGIYFAANKEPDDPVRAPTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPL 1077
            ..|.||..:...:..:.|..:.|||:..||:.|||.|||..::.:|:||....:.:|.. .|:|.
 Worm   980 KAIDFAFEEYDKENHQMPKNIFFLEIAIEFSGKLLAQDKMAVVRYLNKIYTNRVGTSTV-VWEPY 1043

  Fly  1078 ILYRNSLL-HGETDQAPVASKRAYT 1101
            .||..||. ..:.|...|.|....|
 Worm  1044 RLYLGSLSDRNDDDNMSVRSGMTVT 1068

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 45/109 (41%)
scc-3NP_506193.1 STAG 184..286 CDD:285686 44/103 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59626381
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 586 1.000 Inparanoid score I540
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T476815
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 LDO PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.