DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and Stag3

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_446182.1 Gene:Stag3 RGDID:621333 Length:1256 Species:Rattus norvegicus

Alignment Length:1087 Identity:426/1088 (39%)
Similarity:660/1088 (61%) Gaps:68/1088 (6%)


  Fly    58 DDDEDDFFAPIARKRKTPATRKGPTERKERVERPRKEP--VDKGHHERIDSEREI--TTDENSLY 118
            |.|.:|......|||    ..|.|.:.....:.|:|:.  |..|:    |..:.:  |:|   |:
  Rat    63 DSDFEDSLRRNVRKR----AAKRPPKAIPVAKHPKKQSHIVPGGN----DKNKSVPPTSD---LF 116

  Fly   119 YIVRHSKNPIASIVDQWIEQYKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTE 183
            ..|:.:::...|:||:|:|.||.:.....:.|:.|||.|.|||..::.::...:.::.||:.:||
  Rat   117 DAVKAARSCAQSLVDEWLENYKQDENAGFLELVNFFIRACGCKSTVTPEMFKTMSNSEIIQHLTE 181

  Fly   184 EFDEESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAF 248
            ||:|:||:|||...|..|:||:.:||:||:|||.|||||:::|.|.||::||||.||||||||||
  Rat   182 EFNEDSGDYPLTAPGPSWKKFQGSFCEFVKTLVCQCQYSLLFDGFPMDDLISLLIGLSDSQVRAF 246

  Fly   249 RHTATLAAMKLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDE 313
            |||:|||||||||:||.|||.:|.:.||..:|:||||.|..::||.:||:||:.||.|.:||.:|
  Rat   247 RHTSTLAAMKLMTSLVKVALQLSLHKDNNQRQYEAERNKGPEQRAPERLESLLEKRKEFQENQEE 311

  Fly   314 IKSMLTYMFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRL 378
            |:.|:..:|:.||||||||.||:|||:|:.|||.||::|..:||:||||||||||||||..||||
  Rat   312 IEGMMNAIFRGVFVHRYRDILPEIRAVCIEEIGCWMQSYSTSFLNDSYLKYIGWTLHDKHKEVRL 376

  Fly   379 RCLQSLLPLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDC 443
            :|:::|..||...||..::||||::||||:|:|.:|:|.||:|.|::|:..|||....:|...||
  Rat   377 KCVKALAGLYSNQELSSRMELFTNRFKDRMVSMVMDRESEVAVEAIRLLTLILKNMEGVLTSADC 441

  Fly   444 EIVYELVYSSHRGVAQAAAEFLNVRLFHLTADMEETKTKRGKVRMPNTPLVRD----LVQFFIES 504
            |.:|.:||.|:|.:|.:|.||:..::||....   .|...|:.|..:....|.    |:.||:||
  Rat   442 EKIYSIVYISNRAMASSAGEFVYWKIFHPECG---AKAVSGRERRRSPQAQRTFIYLLLAFFMES 503

  Fly   505 ELHEHGAYLVDSFID-SNDMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGE 568
            |.|:|.||||||..| :...::|||.:|.|||::    ::.|.:.||..||||:|||.:|:|.|.
  Rat   504 EHHDHAAYLVDSLWDCAGSYLKDWESLTSLLLQK----DQNLGDMQERMLIEILVSSARQAAEGH 564

  Fly   569 VPVGRASNRKCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLY 633
            .||||.:.:| :|:|||.|....:|.||.||.|..||.||.|:.||:|.:|.||.:..|||||:|
  Rat   565 PPVGRITGKK-SLTAKERKLQAYDKVKLAEHLIPLLPQLLAKFSADAENVAPLLRLLSYFDLNIY 628

  Fly   634 TTNRQEGNLQALLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKY 698
            .|.|.|.:|:.||.::.:|:..|...||||..|..|..||......::|.:.|||.:::...:::
  Rat   629 CTQRLEKHLELLLQQLQEVVVKHVEPEVLEAAAHALYLLCKPEFTFFSRVDFARSQLVDLLTDRF 693

  Fly   699 KDAIEEWRNLIQGEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDR 763
            :..:::   |:|.... :||::|::|.|||.||..|::|:|..||:.:...:.:.:|.....:  
  Rat   694 QQELDD---LMQSSFL-DEDEVYSLTATLKRLSAFYNAHDLTRWEISEPCSRLLRKAVDTGEV-- 752

  Fly   764 CLPNEALVYCIEACYFSISWGLQYVENECESVNVTEVVAELRNNLDTFMGACFELTRD-GPTVQI 827
              |::.::..:...||||.|.:.::.   ||.:..:::: |:..:..|...|.....| .|  :|
  Rat   753 --PHQVILPALTLVYFSILWTVTHIS---ESTSQKQLMS-LKKRMVAFCELCQSCLSDVDP--EI 809

  Fly   828 QEAAYQSICDLLIIFSDKLARSEIEHIRGLEYKSRMDEHLILDNFVQHYVFSLKQDVA-----QD 887
            ||.|:..:.|||:|||.::.....:.:|.|.:.........|.:|:..:||....::.     :|
  Rat   810 QEQAFVLLSDLLLIFSPQMVVGGRDFLRPLVFFPEATLQSELASFLMDHVFLQPGELGNGQSQED 874

  Fly   888 ETRIEELHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFA 952
            ..:||.||::|..||.:|||::|.::....|:.:||:|.|.|.|||||||.||.:||:|::...:
  Rat   875 HVQIELLHQRRRLLAGFCKLLLYGVLELDAASDVFKHYNKFYEDYGDIIKETLTRARQIDRCQCS 939

  Fly   953 MTLLLSLITVFKSL-QEQSEDGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIY 1016
            ..|||||..::..| |||....:....:  |:::::||:||||:||...:.||:.|..:|:.||.
  Rat   940 RILLLSLKQLYTELIQEQGPQDLTELPA--FIEMRDLARRFALSFGPQQLHNRDLVVMLHKEGIK 1002

  Fly  1017 FAANK-EPDDPVRAPTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKII-----PPAMPSSRAEEWQ 1075
            |:.:: .|....|.|..:.|||:|:||:.:|..|||::::|:|:|.:     .|:.|      |.
  Rat  1003 FSLSELPPAGSSREPPNIAFLELLSEFSPRLFHQDKQLLLSYLEKCLQRVSMAPSHP------WG 1061

  Fly  1076 PLILYRNSLLHGE-----TDQAPVASKRAYTRKRRDHDEEEEEEEDE 1117
            |:..|.:||...|     :.|.|..||:......|...|||...:.|
  Rat  1062 PVTTYCHSLHLVENTAEASSQGPPHSKKRCIEVPRRLQEEESSSQGE 1108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 68/108 (63%)
Stag3NP_446182.1 STAG 188..296 CDD:285686 68/108 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62855334
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 890 1.000 Inparanoid score I360
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T618841
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.