DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and STAG2

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_001036214.1 Gene:STAG2 HGNCID:11355 Length:1268 Species:Homo sapiens

Alignment Length:1053 Identity:489/1054 (46%)
Similarity:698/1054 (66%) Gaps:50/1054 (5%)


  Fly    78 RKGPTERKERVERPRKEPVD----KGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQ 138
            :|||.|:.:......|.|..    .|||::...|..:      |:.:|:..|:.:.|:||.|||.
Human    47 KKGPAEKGKGGNGGGKPPSGPNRMNGHHQQNGVENMM------LFEVVKMGKSAMQSVVDDWIES 105

  Fly   139 YKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRK 203
            ||.:|:.||:.|:.|||..|||||.::.::...:.::.|||:|||||||:||:|||.|:|.||:|
Human   106 YKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKK 170

  Fly   204 FKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVAL 268
            ||::||:|:..||:|||||||||:::||.|||||||||||||||||||:||||||||||||:|||
Human   171 FKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVAL 235

  Fly   269 LVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDS 333
            .:|.|.||..:|:||||.|...:||::||:.|:.||.||:||.|||::|:..:||.||||||||:
Human   236 NLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDA 300

  Fly   334 LPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLE 398
            :.:|||||:.||||||:.|...||:||||||:|||:|||.|||||:||.:|..||...||..|||
Human   301 IAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELNSKLE 365

  Fly   399 LFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAE 463
            ||||:||||||:||||||::|:|.|:||:..:|:...|:|..:|||.||.||||:||.||.||.|
Human   366 LFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSAHRPVAVAAGE 430

  Fly   464 FLNVRLFHLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFID-SNDMVRDW 527
            ||..:||......|:...||...:.||..||:.||.||:|||||||.||||||..| :.::::||
Human   431 FLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAYLVDSMWDCATELLKDW 495

  Fly   528 ECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDE 592
            |||..||||||...||.|.::|||.|||||:.:::|:|....||||.:.:: .|:|||.|...|:
Human   496 ECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKR-VLTAKEKKTQLDD 559

  Fly   593 KAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHT 657
            :.|:||.|.|.||.||.||..|:||:.|||.:||||||.:|||.|.|.:|.|||.:|..::..||
Human   560 RTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHT 624

  Fly   658 GREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIYN 722
            ..:|||.|:||...||.|....:.|.:|:||.:|:...:|:...:|::  |.:||| |:|||.|.
Human   625 DTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDF--LQEGEE-PDEDDAYQ 686

  Fly   723 ITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNEALVYCIEACYFSISWGLQY 787
            :..|||.::..:::|:|:.|:||...::.::  ...||.|  :|.:.:::.::..::.|.|.|..
Human   687 VLSTLKRITAFHNAHDLSKWDLFACNYKLLK--TGIENGD--MPEQIVIHALQCTHYVILWQLAK 747

  Fly   788 VENECESVNVTEVVAELRNNLDTFMGAC-FELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSEI 851
            :   .||.:..|.:..|:..:..|...| ..||....||  :|.|:..:||:|:|||.::.....
Human   748 I---TESSSTKEDLLRLKKQMRVFCQICQHYLTNVNTTV--KEQAFTILCDILMIFSHQIMSGGR 807

  Fly   852 EHIRGLEY--KSRMDEHLILDNFVQHYVFSLKQD--------VAQDE-TRIEELHKKRNFLACYC 905
            :.:..|.|  .|.:...|:  :|:..:|| ::||        ..:|| ::||.|||:||.||.:|
Human   808 DMLEPLVYTPDSSLQSELL--SFILDHVF-IEQDDDNNSADGQQEDEASKIEALHKRRNLLAAFC 869

  Fly   906 KLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKSLQEQS 970
            ||:||.::....||.|||.|:|.|||||||||.|:.|.|:|:|:..|.||:|||..:|..:.:  
Human   870 KLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQ-- 932

  Fly   971 EDGI-VSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFAANKEPDDPVRA--PTR 1032
            |:|. ..:||..|..:||||:|||||||.|.:|.||::|.:|:.||.||. |||:....:  |..
Human   933 ENGYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEFAF-KEPNPQGESHPPLN 996

  Fly  1033 LLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLLHGETDQ-----A 1092
            |.||::|:||:.|||:|||:.:..:|:|.:...|...|.:.|.||:.||||||.|..|.     :
Human   997 LAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVIS 1061

  Fly  1093 PVASKRAYTRKRR 1105
            .::|:.:..|.::
Human  1062 GISSRGSTVRSKK 1074

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 75/108 (69%)
STAG2NP_001036214.1 STAG 157..265 CDD:312124 75/108 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62896900
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 904 1.000 Inparanoid score I373
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T609906
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 LDO PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.