DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and STAG3

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_016867172.1 Gene:STAG3 HGNCID:11356 Length:1239 Species:Homo sapiens

Alignment Length:1152 Identity:451/1153 (39%)
Similarity:687/1153 (60%) Gaps:92/1153 (8%)


  Fly    30 STSDADSPTKRMTRLRARGGVRDKPPIIDDDEDDFFAPIARKRKTPATRKGPTERKERVERPRKE 94
            |:|.|..|...........|..|.  ::.|::.||...:.|..|..|.:: |.:.....:.|:|.
Human    20 SSSSASLPFDDRDSNHTSEGNGDS--LLADEDTDFEDSLNRNVKKRAAKR-PPKTTPVAKHPKKG 81

  Fly    95 PVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQYKANRETALVALMQFFINASG 159
            ......|.|..||    ...|.|:..|:.:|:.:.|:||:|::.||.:::...:.|:.|||.:.|
Human    82 SRVVHRHSRKQSE----PPANDLFNAVKAAKSDMQSLVDEWLDSYKQDQDAGFLELVNFFIQSCG 142

  Fly   160 CKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSII 224
            |||.::.::...:.::.||:.:||:|:|:||:||||..|..|:||:.:||:||:|||.|||||::
Human   143 CKGIVTPEMFKKMSNSEIIQHLTEQFNEDSGDYPLIAPGPSWKKFQGSFCEFVRTLVCQCQYSLL 207

  Fly   225 YDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVALLVSNNFDNAAKQFEAERVKSR 289
            ||.|.||::||||||||||||||||||:|||||||||:||.|||.:|.:.||..:|:||||.|..
Human   208 YDGFPMDDLISLLTGLSDSQVRAFRHTSTLAAMKLMTSLVKVALQLSVHQDNNQRQYEAERNKGP 272

  Fly   290 DRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQ 354
            .:||.:||:||:.||.||:|:.:||:.|:..:|:.||||||||.||:|||||:.|||.||::|..
Human   273 GQRAPERLESLLEKRKELQEHQEEIEGMMNALFRGVFVHRYRDVLPEIRAICIEEIGCWMQSYST 337

  Fly   355 NFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEV 419
            :||.||||||||||||||..||||:|:::|..||...:|..:||||||:||||:|:|.:|:|::|
Human   338 SFLTDSYLKYIGWTLHDKHREVRLKCVKALKGLYGNRDLTTRLELFTSRFKDRMVSMVMDREYDV 402

  Fly   420 SVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAEFLNVRLFHLTADM-----EET 479
            :|.||:|:|.|||....:|.|.|||.||.:||:||||:|.||.|||..:||:...::     .|.
Human   403 AVEAVRLLILILKNMEGVLTDADCESVYPVVYASHRGLASAAGEFLYWKLFYPECEIRMMGGREQ 467

  Fly   480 KTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFID-SNDMVRDWECMTDLLLEEPGPNEE 543
            :...|..|    ...:.|:.||:|||||:|.||||||..| :...::|||.:|.||||:    ::
Human   468 RQSPGAQR----TFFQLLLSFFVESELHDHAAYLVDSLWDCAGARLKDWEGLTSLLLEK----DQ 524

  Fly   544 VLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQDEKAKLTEHFIVTLPSLL 608
            .|.:.||||||||:|||.:|::.|..||||.:.|| .|::||.|...|::.|||||.|..||.||
Human   525 NLGDVQESTLIEILVSSARQASEGHPPVGRVTGRK-GLTSKERKTQADDRVKLTEHLIPLLPQLL 588

  Fly   609 EKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHTGREVLETCAKTLECLC 673
            .|:.||:||:..||.:...|||::|.|.|.|.:|:..|.::.:|:..|....|||..|..|..||
Human   589 AKFSADAEKVTPLLQLLSCFDLHIYCTGRLEKHLELFLQQLQEVVVKHAEPAVLEAGAHALYLLC 653

  Fly   674 AEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIYNITITLKVLSILYSSHN 738
            ......::|.:.|||.:::...::::..:||   |:|.... :||::||:..|||.||..|::|:
Human   654 NPEFTFFSRADFARSQLVDLLTDRFQQELEE---LLQSSFL-DEDEVYNLAATLKRLSAFYNTHD 714

  Fly   739 LNPWELFKSLFQDVEEAQSKENIDRCLPNEALVYCIEACYFSISWGLQYVENECESVNVTEVVAE 803
            |..|||::...|.:::|.....:    |::.::..:...||||.|.|.::.....|   .:.::.
Human   715 LTRWELYEPCCQLLQKAVDTGEV----PHQVILPALTLVYFSILWTLTHISKSDAS---QKQLSS 772

  Fly   804 LRNNLDTFMGACFELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSEIEHIRGLEYKSRMDEHLI 868
            ||:.:..|...|.....|..| :|||.|:..:.|||:|||.::.....:.:|.|.:.........
Human   773 LRDRMVAFCELCQSCLSDVDT-EIQEQAFVLLSDLLLIFSPQMIVGGRDFLRPLVFFPEATLQSE 836

  Fly   869 LDNFVQHYVFSLKQDVA-----QDETRIEELHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKC 928
            |.:|:..:||....|:.     :|..:||.||::|..||.:|||::|.::....|:.:||:|.|.
Human   837 LASFLMDHVFIQPGDLGSGDSQEDHLQIERLHQRRRLLAGFCKLLLYGVLEMDAASDVFKHYNKF 901

  Fly   929 YNDYGDIIKATLGKAREINKVNFAMTLLLSLITVF-KSLQEQSEDGIVSKSSQEFVDLKELAKRF 992
            |||||||||.||.:||:|::.:.:..|||||..:: :.|||....|:  .....|:::::||:||
Human   902 YNDYGDIIKETLTRARQIDRSHCSRILLLSLKQLYTELLQEHGPQGL--NELPAFIEMRDLARRF 964

  Fly   993 ALTFGFDAIKNRESVAAIHRGGIYFAANK-EPDDPVRAPTRLLFLEVLNEFNYKLLKQDKKVIMS 1056
            ||:||...::||:.|..:|:.||.|:.:: .|......|..|.|||:|:||:.:|..|||::::|
Human   965 ALSFGPQQLQNRDLVVMLHKEGIQFSLSELPPAGSSNQPPNLAFLELLSEFSPRLFHQDKQLLLS 1029

  Fly  1057 FLDKII-----PPAMPSSRAEEWQPLILYRNSLLHGE-----TDQAPVASKRAYTR-----KRRD 1106
            :|:|.:     .|..|      |.|:..|.:||...|     :.|...:|||....     .|.|
Human  1030 YLEKCLQHVSQAPGHP------WGPVTTYCHSLSPVENTAETSPQVLPSSKRRRVEGPAKPNRED 1088

  Fly  1107 HDEEEEE----------------------------EEDEEEHNDPDY 1125
            ....:||                            |.:||:.::.|:
Human  1089 VSSSQEESLQLNSIPPTPTLTSTAVKSRQPLWGLKEMEEEDGSELDF 1135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 71/108 (66%)
STAG3XP_016867172.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62845977
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 904 1.000 Inparanoid score I373
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T609906
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.