DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and STAG1

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_005853.2 Gene:STAG1 HGNCID:11354 Length:1258 Species:Homo sapiens

Alignment Length:1186 Identity:521/1187 (44%)
Similarity:736/1187 (62%) Gaps:135/1187 (11%)


  Fly    25 DALNESTSDADSPTK------RMTRLRARGGVRDKPPIIDDDEDDFFAPIARKRKTPATRKGPTE 83
            |:.||:|:.:|:.::      :..|.|.|.|   :||              ...|.|  ||.|.|
Human    11 DSTNETTAHSDAGSELEETEVKGKRKRGRPG---RPP--------------STNKKP--RKSPGE 56

  Fly    84 RKERVE---------RPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQY 139
             |.|:|         |....|...|..|.:           :|:.:|:..|:.:.|:||.|||.|
Human    57 -KSRIEAGIRGAGRGRANGHPQQNGEGEPV-----------TLFEVVKLGKSAMQSVVDDWIESY 109

  Fly   140 KANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWRKF 204
            |.:|:.||:.|:.|||..|||:|.:..::...:.:..|||:|||||||:||:|||.|.|.||:||
Human   110 KQDRDIALLDLINFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKF 174

  Fly   205 KNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVALL 269
            ::|||:|:..|::|||||||||:::||.|||||||||||||||||||:||||||||||||:|||.
Human   175 RSNFCEFIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALN 239

  Fly   270 VSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRDSL 334
            :|.:.||..:|:||||.|...:||::||:.|:.||.||:||.|||::|:..:||.:|||||||::
Human   240 LSIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRYRDAI 304

  Fly   335 PDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKLEL 399
            .:|||||:.|||:||:.|...||:||||||:||||||:.|||||:||::|..||...||..||||
Human   305 AEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTNRELFPKLEL 369

  Fly   400 FTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAAEF 464
            ||::||||||:||||||::|:|.|::||..||....|.|:::|||.||.||||:||.||.||.||
Human   370 FTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLVYSAHRPVAVAAGEF 434

  Fly   465 LNVRLF--HLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFIDSN-DMVRD 526
            |:.:||  | ....||...||.....||..|:|.||.||:|||||||.||||||..:|: ::::|
Human   435 LHKKLFSRH-DPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKD 498

  Fly   527 WECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAIQD 591
            |||||:||||||...||.:.::|||.|||:||.:::|:|....||||.:.:: .|:|||.|...|
Human   499 WECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAHPPVGRGTGKR-VLTAKERKTQID 562

  Fly   592 EKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMSMH 656
            ::.|||||||:|||.||.||.||:||:||||.:||||||.:|:|.|.|.:|.|||.:|..|:..|
Human   563 DRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKH 627

  Fly   657 TGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDDIY 721
            ...:|||.|:||...||:|......|.:||||.:|:..|:::..::|:   |:|..|..::||||
Human   628 VESDVLEACSKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVED---LLQEGEEADDDDIY 689

  Fly   722 NITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDR-CLPNEALVYCIEACYFSISWGL 785
            |:..|||.|:..:::|:|..|:||.:.::.:     |..|:. .:|.:.:|..::..::||.|.|
Human   690 NVLSTLKRLTSFHNAHDLTKWDLFGNCYRLL-----KTGIEHGAMPEQIVVQALQCSHYSILWQL 749

  Fly   786 QYVENECESVNVTEVVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSE 850
            ..:.:...|   .|.:..||..:.:|:..|.:...:..| .::|.|:..:||||:|||.:|....
Human   750 VKITDGSPS---KEDLLVLRKTVKSFLAVCQQCLSNVNT-PVKEQAFMLLCDLLMIFSHQLMTGG 810

  Fly   851 IEHIRGLEYKSRMDEHLILDNFVQHYVF--------SLKQDVAQDETRIEELHKKRNFLACYCKL 907
            .|.::.|.:.........|.:||..:||        |::.|...:..:||.|||:||.||.:.||
Human   811 REGLQPLVFNPDTGLQSELLSFVMDHVFIDQDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKL 875

  Fly   908 VVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKSL-QEQSE 971
            ::|:|:....||.|||:|:|.|||||||||.||.|.|:|:|:..|.||:|||..:|..| |||..
Human   876 IIYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGP 940

  Fly   972 DGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFA----ANKEPDDPVRAPTR 1032
            :  :.::|.....:||||:|||||||.|.||.||:||.:|:.||.||    ..|..:.|   |..
Human   941 N--LDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYP---PPN 1000

  Fly  1033 LLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLL-HGETDQAPV-- 1094
            |.|||||:||:.|||:||||.:.|:|:|.:...|...|.:.|.|||.|||||: .||.|:..|  
Human  1001 LAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNS 1065

  Fly  1095 ---ASKRAYTR---------KRRDHDEE------------------------------------- 1110
               :||.:..|         |:|..||.                                     
Human  1066 GSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTSTVLRENSRPMG 1130

  Fly  1111 EEEEEDEEEH-NDPDY 1125
            ::.:|.|.|| ::||:
Human  1131 DQIQEPESEHGSEPDF 1146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 73/108 (68%)
STAG1NP_005853.2 RFX5_DNA_bdg 3..>58 CDD:317070 18/67 (27%)
STAG 160..268 CDD:312124 73/108 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62862253
eggNOG 1 0.900 E1_COG5537
Hieranoid 1 1.000
Homologene 1 1.000 H21191
Inparanoid 1 1.050 904 1.000 Inparanoid score I373
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T609906
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3773
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.