DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and LOC102553065

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_006257787.2 Gene:LOC102553065 RGDID:7729409 Length:426 Species:Rattus norvegicus

Alignment Length:440 Identity:146/441 (33%)
Similarity:249/441 (56%) Gaps:23/441 (5%)


  Fly   580 TLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQA 644
            :|:|||.|....:|.||.||.|..||.||.|:.||:|.:|.||.:..|||||:|.|.|.|.:|:.
  Rat     3 SLTAKERKLQAYDKVKLAEHLIPLLPQLLAKFSADAENVAPLLRLLSYFDLNIYCTQRLEKHLEL 67

  Fly   645 LLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLI 709
            ||.::.:|:..|...||||..|..|..||......::|.:.|||.:::...::::..:::   |:
  Rat    68 LLQQLQEVVVKHVEPEVLEAAAHALYLLCKPEFTFFSRVDFARSQLVDLLTDRFQQELDD---LM 129

  Fly   710 QGEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNEALVYCI 774
            |.... :||::|::|.|||.||..|::|:|..||:.:...:.:.:|.....:    |::.::..:
  Rat   130 QSSFL-DEDEVYSLTATLKRLSAFYNAHDLTRWEISEPCSRLLRKAVDTGEV----PHQVILPAL 189

  Fly   775 EACYFSISWGLQYVENECESVNVTEVVAELRNNLDTFMGACFELTRD-GPTVQIQEAAYQSICDL 838
            ...||||.|.:.::.   ||.:..:::: |:..:..|...|.....| .|  :|||.|:..:.||
  Rat   190 TLVYFSILWTVTHIS---ESTSQKQLMS-LKKRMVAFCELCQSCLSDVDP--EIQEQAFVLLSDL 248

  Fly   839 LIIFSDKLARSEIEHIRGLEYKSRMDEHLILDNFVQHYVFSLKQDVA-----QDETRIEELHKKR 898
            |:|||.::.....:.:|.|.:.........|.:|:..:||....::.     :|..:||.||::|
  Rat   249 LLIFSPQMVVGGRDFLRPLVFFPEATLQSELASFLMDHVFLQPGELGNGQSQEDHVQIELLHQRR 313

  Fly   899 NFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVF 963
            ..||.:|||::|.::....|:.:||:|.|.|.|||||||.||.:||:|::...:..|||||..::
  Rat   314 RLLAGFCKLLLYGVLELDAASDVFKHYNKFYEDYGDIIKETLTRARQIDRCQCSRILLLSLKQLY 378

  Fly   964 KSL-QEQSEDGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHR 1012
            ..| |||....:....:  |:::::||:||||:||...:.||:.|..:|:
  Rat   379 TELIQEQGPQDLTELPA--FIEMRDLARRFALSFGPQQLHNRDLVVMLHK 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686
LOC102553065XP_006257787.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.