DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and si:ch211-269e2.1

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_017213324.1 Gene:si:ch211-269e2.1 ZFINID:ZDB-GENE-070912-267 Length:1174 Species:Danio rerio

Alignment Length:1115 Identity:406/1116 (36%)
Similarity:623/1116 (56%) Gaps:89/1116 (8%)


  Fly    69 ARKRKTPATRKGPTERKERVERPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVD 133
            ||:....|.||........:.|...|.:..|..|.:           :|:.:|...:|.:.::||
Zfish    48 ARECSENAKRKHSKSSNGSLGRAENEQLKNGDVEAV-----------TLFEVVSMGRNAMQAVVD 101

  Fly   134 QWIEQYKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDE----------- 187
            .||:.|..:|:|||:.|:.|||..|||||.::.::......|.::.:|.|:.||           
Zfish   102 DWIDAYTVDRDTALLDLISFFIQCSGCKGMVTAEMFQSKQGTDVMSKMVEDLDEDAGFQYKKFLA 166

  Fly   188 -------------ESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTG 239
                         :||||||||||..|::|:::||:|:..||.|||..:|:|.:|::.:|||||.
Zfish   167 FPWILTVTWPLDMDSGEYPLIMSGLYWKRFRSHFCEFISVLVAQCQSCVIFDGYLLNTLISLLTE 231

  Fly   240 LSDSQVRAFRHTATLAAMKLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKR 304
            ||||:|||||||.||||:||::|||:|||.:|.:.||:.:.:|.|..|...:|||.|||.:..|.
Zfish   232 LSDSRVRAFRHTCTLAAVKLLSALVNVALNLSVSVDNSQRLYEVELAKMASKRASPRLDRIQRKI 296

  Fly   305 SELEENMDEIKSMLTYMFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTL 369
            |||::...||::|:..:||.||:.||||.:|:||:|||.|:.:||:.|...||:||||||:||.:
Zfish   297 SELQDRKLEIENMMDAIFKGVFLKRYRDVIPEIRSICMEELTVWMKLYSSVFLNDSYLKYVGWMM 361

  Fly   370 HDKIGEVRLRCLQSLLPLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIH 434
            |||..:|||:|:..|..||: |:...|::|||.:||:|:::|||||:.||::.||:|::.|.:..
Zfish   362 HDKQPDVRLKCVLGLQGLYQ-DQNSSKMDLFTVRFKERMISMTLDKDHEVAIQAVRLLMVISQSC 425

  Fly   435 PEILADKDCEIVYELVYSSHRGVAQAAAEFLNVRLFHLTADMEETKTKRG-----KVRMPNTPLV 494
            .::|:..|.:.|.:.||.|||.:|..|.:||..||.   ::.|.:.|:.|     :.|......|
Zfish   426 EDVLSPDDHKNVLQFVYCSHRPLATTAGQFLYNRLL---SNPELSTTRNGGSNQDRHRELVLAKV 487

  Fly   495 RDLVQFFIESELHEHGAYLVDSFIDSND-MVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMV 558
            |.|:.|..||:||:|..|||||..||.. :::||..:|.|||......::.|.:.:|:.:||:||
Zfish   488 RALINFHTESKLHQHVLYLVDSLWDSGGALLKDWTGLTSLLLPHTSCQDQALSSAEEAFVIELMV 552

  Fly   559 SSVKQSATGEVPVGRASNRKCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLA 623
            :||:|:|.|....||.:.:| .:|.||.|...|:.||||||||..||.||.||..|:|||.:.|.
Zfish   553 ASVRQAAEGPPLSGRGAGKK-VISTKEKKLQTDDCAKLTEHFIKALPGLLSKYSEDAEKLTSFLR 616

  Fly   624 VPQYFDLNLYTTNRQEGNLQALLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARS 688
            :|:||.::.......:..| |||..:...::.||...:|||.|::.:.|||:.||.::....|..
Zfish   617 IPRYFQMDTCDPENSQCVL-ALLAELETAVNRHTDVVLLETSARSYQSLCAQDSAFHSLARPAFD 680

  Fly   689 NIIESAVNKYKDAIEEWRNLIQGEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQDVE 753
            .:|:...|.....:.|  :|.....|.|||::..|..|||.|:....:.:|:.|.|:: |...:.
Zfish   681 QLIQHWTNTLGTRLAE--SLSDDCFTYNEDNVLEILSTLKKLAAFNIAQDLSKWSLYE-LVTKLL 742

  Fly   754 EAQSKENIDRCLPNEALVYCIEACYFSISWGLQYVENECESVNVTEVVAELRNNLDTFMGACFEL 818
            |.:.|..   .||.|..:..:......|.|.|....   |.:...|...:.||.|..|...|...
Zfish   743 EGELKHG---GLPVEVTIEALRCMCSCILWKLNTFG---EGLTSRESALQQRNQLRAFCEKCHRC 801

  Fly   819 TRDGPTVQIQEAAYQSICDLLIIFSDKLARSEIEHIRGLEYKSRMDEHLILDNFVQHYVF----- 878
            ......: ::|.|:..:.|:||..:.:|...:......|.|.........|.:|:..::|     
Zfish   802 LSHAEQL-VREHAFMCLSDVLIAHNYQLQMWDSSAGTPLLYTPDPKLQKALLSFILEHIFISPDP 865

  Fly   879 -SLKQDVAQDET---RIEELHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKAT 939
             |....|::.|:   |:|:||::||.|:.||||:|::::....||.:||.|||.|||:|||||.|
Zfish   866 DSHSSKVSESESGEGRLEDLHRRRNLLSAYCKLIVHSVLEMSMAAEVFKQYVKYYNDFGDIIKET 930

  Fly   940 LGKAREINKVNFAMTLLLSLITVFKSL-QEQSEDGIVSKSSQEFVDLKELAKRFALTFGFDAIKN 1003
            |.:.|:::|:..|.||:..|..::..| |||......|...|.:..:||||:||:||||:|.||:
Zfish   931 LNRTRQMDKMESARTLVQCLQQLYLRLKQEQDRGNTCSSRIQTYSSIKELARRFSLTFGWDQIKS 995

  Fly  1004 RESVAAIHRGGIYFA-------ANKEPDDPVRAPTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKI 1061
            |||:|.|||.||.|.       :.|:      :|..:.:|.:|:||:.||||.|||.|..:|.|.
Zfish   996 RESLAMIHRDGIEFVFQGFVQQSEKQ------SPPYVSYLTILSEFSSKLLKPDKKTIYGYLQKF 1054

  Fly  1062 IPPAMPSSRAEEWQPLILYRNSLL---HGETDQAPVAS----KRAYTRKRRDHDEEEEEEEDEEE 1119
            ....:.|:|.|.|.|||.||.||:   .||...:.::|    :.:.|.:.|.......:.|.|:.
Zfish  1055 AGEQVISNREESWMPLIYYRASLMGTAEGEDAVSFISSDTNKQPSLTNRSRSPSIRLVQSEGEQR 1119

  Fly  1120 HNDP--DYRG 1127
            ...|  :.||
Zfish  1120 FLSPSTELRG 1129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 61/108 (56%)
si:ch211-269e2.1XP_017213324.1 STAG 182..290 CDD:285686 61/108 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62882735
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 1 1.000 T597592
orthoMCL 1 0.900 OOG5_127983
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.