DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and LOC100486631

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_002937020.2 Gene:LOC100486631 ID: Length:1158 Species:Xenopus tropicalis

Alignment Length:1126 Identity:400/1127 (35%)
Similarity:629/1127 (56%) Gaps:118/1127 (10%)


  Fly    20 EELHS---DALNESTSDADSPTKRMTRLRARGGVRDKPPIIDDDEDDFFAPIARKRKTPATRKGP 81
            ||.||   ::|:...:..::.|:....:               |.:....|.|||.:..:...  
 Frog     8 EEEHSLSQESLHLENNQGENNTQAQKNV---------------DCESLVTPKARKIRRQSENH-- 55

  Fly    82 TERKERVERPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIEQYKANRETA 146
             .||...:|.:...:..|     |....:|     |:.:|...|..|.|:|..|:|.|:.:|:.|
 Frog    56 -SRKSSRKRSKDSQITNG-----DRAEAVT-----LFEVVCIGKGAIQSVVSDWVEVYQEDRDAA 109

  Fly   147 LVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDE------------------------ 187
            |:.|:.|:|..|||:|.::.::........|::::||||||                        
 Frog   110 LLDLLNFYIQCSGCQGVVTAEMFQNQGDKDIMQKLTEEFDEETGLQFKKFMAFPWILTITLADNM 174

  Fly   188 ESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTA 252
            |:|||||..:|..|:||:.|.|:....:|::||||:|||.:|:|.|||||.|||||.:||||||:
 Frog   175 ENGEYPLSKAGNYWKKFRANICELTAVIVQKCQYSVIYDGYLLDTVISLLLGLSDSCIRAFRHTS 239

  Fly   253 TLAAMKLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSM 317
            ||:|:||.||||.|.|.:..:..|..:.:..|:.:...::.|.|::.:..|::||::..||||||
 Frog   240 TLSAVKLNTALVRVMLNLEISIHNLQRLYNVEQKRFTLKKDSYRMEQIEKKKNELQQKHDEIKSM 304

  Fly   318 LTYMFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQ 382
            :..:||...|.||||.:.|||::|:.|:||||:.||:.:|:|||||||||.|:||:.:|||:.|.
 Frog   305 VEALFKGTIVQRYRDVVADIRSLCIEELGIWMKMYPKVYLNDSYLKYIGWMLYDKVYDVRLKSLL 369

  Fly   383 SLLPLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVY 447
            :|..||||| ...|::||:::|||||::||.|::.||||.|:||::.:.:...::|..:||:.:|
 Frog   370 ALQALYEKD-FVDKMDLFSTRFKDRILSMTQDRDHEVSVQAMKLLVRMSQNFEDLLTKEDCDFLY 433

  Fly   448 ELVYSSHRGVAQAAAEFLNVRLFHLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAY 512
            :.||::||.:|.||.|||..|..: .|:.||::..|...|.     .:.|:.|..|::||||..|
 Frog   434 QCVYTTHRPLATAAGEFLYKRYLN-QAEGEESRGTRNNARQ-----FKILLTFICENKLHEHMTY 492

  Fly   513 LVDSFIDSN-DMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASN 576
            ||||..|.| .:::||:|||..||::....|:.|:..||:.||||:::||:|:.....||||.:.
 Frog   493 LVDSLWDYNPKLLKDWQCMTSALLKDTQNGEDALNAIQENLLIEIILASVRQAVEVHPPVGRGTV 557

  Fly   577 RKCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGN 641
            || .|||:|.:...:::.|:||||..|||.||.||..|..|:.|||.:.|||...:|::|..:.:
 Frog   558 RK-MLSAREKRVQLEDQIKITEHFARTLPLLLAKYLPDQRKVVNLLQILQYFKFEVYSSNGLDKD 621

  Fly   642 LQALLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWR 706
            |:|||:.:..|...|:..||||.|:|....:..|...:.....:|:..:||..|:.:...:   |
 Frog   622 LKALLNELKHVAMTHSDPEVLEACSKAYMSMGKENVESLVSVVLAKRQLIEQLVDMFSQML---R 683

  Fly   707 NLIQ-GEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKS----LFQDVEEAQSKENIDRCLP 766
            :::| |||..:.:.::.::..||.|:..:::|:.:.|.|::.    |..|:|.        ....
 Frog   684 DMLQEGEEPLSSEGVHQMSCILKKLAAFHNAHDPSEWNLYEKTSQLLLYDLEH--------HWFS 740

  Fly   767 NEALVYCIEACYFSISWG----LQYVENECESVNVTEVVAELRNNLDTFMGAC--FELTRDGPTV 825
            .:.||...:..|:::.|.    ::..|::.|.....|.||       ||...|  :...:||   
 Frog   741 VQLLVPAFQCMYYALLWNVVAVMEGTESKVEPAFFKEHVA-------TFWQLCKHYLNHQDG--- 795

  Fly   826 QIQEAAYQSICDLLIIFSDKLARSEIEHIRGLEYKSRMDEHL--ILDNFVQHYVFSLKQDVAQDE 888
            .:||.|:.|:||:|::.|         |.|...| ..||..|  .|..||||:||...::..:..
 Frog   796 SVQEQAFMSMCDILLLLS---------HYRDGIY-CYMDSALQSELFAFVQHHVFQSDEEKPKAT 850

  Fly   889 TRIEE--------LHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKARE 945
            .|.|:        |||:|..||.||||:.|||:....|..|:|.|:|.|||:|||||.||.:.|:
 Frog   851 ERSEQDKVMHMEVLHKRRTLLAAYCKLIAYNIVEMAAATEIYKKYMKTYNDFGDIIKETLSRTRQ 915

  Fly   946 INKVNFAMTLLLSLITVFKSLQEQSEDGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAI 1010
            .:::....||:|.|..:|:..:|  ..|..:.||..|.::||:|:|||||||.|.:|.||.:..|
 Frog   916 NDRIESTQTLILCLQQLFQKHRE--AHGSATLSSPSFFNIKEMARRFALTFGMDNVKCRELIVMI 978

  Fly  1011 HRGGIYFAANKEPDDPVRAPTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQ 1075
            |:.||.||..:...:....|..|.||..::||:.||||.|||::..:|.:.....|......||.
 Frog   979 HKQGIEFAFKESALEENLPPPNLPFLIPISEFSGKLLKADKKILYGYLQRFATEQMLLYDGAEWN 1043

  Fly  1076 PLILYRNSLLHGETDQAPVAS 1096
            ||::|.||||....:::...|
 Frog  1044 PLVIYTNSLLDNVDEESSFTS 1064

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 52/108 (48%)
LOC100486631XP_002937020.2 STAG 177..285 CDD:285686 52/108 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.