DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and stag1

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_002931833.2 Gene:stag1 XenbaseID:XB-GENE-998552 Length:1275 Species:Xenopus tropicalis

Alignment Length:1101 Identity:502/1102 (46%)
Similarity:710/1102 (64%) Gaps:59/1102 (5%)


  Fly    58 DDDEDDFFAPIARKRKTPATRKGPTER-KERVERPRKEPVDKGHHERIDSEREITTDENSLYYIV 121
            |.|.||....|. |.|....:||.||: |..:.||.......|||::...|..:      |:.:|
 Frog    43 DTDFDDIEVKIT-KGKGKKGKKGNTEKGKGGLLRPGGPNWMNGHHQQNGVENMM------LFEVV 100

  Fly   122 RHSKNPIASIVDQWIEQYKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFD 186
            :..|:.:.|:||.|||.||.|::.||:.|:.|||..|||||.:|.|:...:.::.||||||||||
 Frog   101 KMGKSAMQSVVDDWIEAYKHNKDVALLDLINFFIQCSGCKGVVSGDMFRHMQNSEIIRRMTEEFD 165

  Fly   187 EESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHT 251
            |:||:|||.|:|.||:|||.:||:|:..||:|||||||||:::||.|||||||||||||||||||
 Frog   166 EDSGDYPLTMAGPQWKKFKFSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHT 230

  Fly   252 ATLAAMKLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKS 316
            :||||||||||||:|||.:|.|.||..:|:||||.|...:||:|||:.|:.||.||:||.|||::
 Frog   231 STLAAMKLMTALVNVALNLSINMDNTQRQYEAERNKMIGKRANDRLELLLQKRKELQENQDEIEN 295

  Fly   317 MLTYMFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCL 381
            |:..:||.||||||||::.:|||||:.|||:||:.|...||:||||||:|||:|||.|||||:||
 Frog   296 MMNAIFKGVFVHRYRDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCL 360

  Fly   382 QSLLPLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIV 446
            .:|..||...||..|||||||:||||||:||||||::|:|.|:||:..:|:...|:|..:|||.|
 Frog   361 TALQGLYHNRELNSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENV 425

  Fly   447 YELVYSSHRGVAQAAAEFLNVRLFHLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGA 511
            |.||||:||.||.||.|||..:||......|:...||.....||..||:.||.||:|||||||.|
 Frog   426 YHLVYSAHRPVAVAAGEFLYKKLFSCRDPEEDGIMKRRGRLSPNANLVKTLVFFFLESELHEHAA 490

  Fly   512 YLVDSFID-SNDMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRAS 575
            |||||..| :.::::|||||..|||::|...||.|.::|||.|||||:.:::|:|....||||.:
 Frog   491 YLVDSMWDCATELLKDWECMNSLLLDDPLNGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGT 555

  Fly   576 NRKCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEG 640
            .:: .|:|||.|:..|:|.:|||.|.|:||.||.||..|:||:.|||.:||||||.:|||.|.|.
 Frog   556 GKR-VLTAKEKKSQMDDKTRLTELFAVSLPQLLAKYSVDAEKVTNLLVLPQYFDLEIYTTGRLEK 619

  Fly   641 NLQALLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEW 705
            :|:|||.:|..::..||..:|||.|:||...||.|....:.|.:||:|.:|:...:|:...:|::
 Frog   620 HLEALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDIAKSQLIDELADKFNRLLEDF 684

  Fly   706 RNLIQGEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNEAL 770
               :|.||..:|||.|.:..|||.::..:::|:|:.|:||...::.::  ...||.|  :|.:.:
 Frog   685 ---LQEEEELDEDDAYQVLSTLKRITAFHNAHDLSRWDLFSGNYKLLK--TGIENGD--MPEQIV 742

  Fly   771 VYCIEACYFSISWGLQYVENECESVNVTEVVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQSI 835
            ::.::..::.|.|.|..:.   |:.:..|.:..|:..:..|...|.....:..|. ::|.|:..:
 Frog   743 IHALQCTHYVILWQLAKIS---ETGSSKEELITLKRQMRVFCQICQHYLTNVNTA-VKEQAFTIL 803

  Fly   836 CDLLIIFSDKLARSEIEHIRGLEYK--SRMDEHLILDNFVQHYVF------SLKQDVAQDE--TR 890
            ||:|:|||.::.....|.:..|.|.  |.:...|:  :|:..:||      :...|..||:  ::
 Frog   804 CDVLMIFSHQIVVGGREALEPLVYSPDSSLQSELL--SFILDHVFIDQDDDNNSSDGQQDDEASK 866

  Fly   891 IEELHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTL 955
            ||.|||:||.||.:|||:|||::.....|.:||.|::.|||||||||.|:.|.|:|:|:..|.||
 Frog   867 IEALHKRRNLLAAFCKLIVYNVVEMNTGADVFKQYMRYYNDYGDIIKETMSKTRQIDKIQCAKTL 931

  Fly   956 LLSLITVF-KSLQEQSEDGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFAA 1019
            :|||..:| :.:||.|.:  ..:||..|..:||||:|||||||.|.:|.||::|.:|:.||.||.
 Frog   932 ILSLQQLFNEMIQEHSYN--FDRSSPTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEFAF 994

  Fly  1020 NKEPDDPVRA--PTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRN 1082
             |||.....|  |..:.||::|:||:.|||:||||.:.::|:|.:...|...|.:.|.||:.|||
 Frog   995 -KEPSPQGEAHPPLNMAFLDILSEFSSKLLRQDKKTVYAYLEKFMTFQMSLRREDVWLPLMSYRN 1058

  Fly  1083 SLLHGETDQ------------APVASKRAY--TRKRRDHDEEEEEEED------EEEHNDP 1123
            |||.|..|.            :...||:..  |.||:..:.||....|      |:..|.|
 Frog  1059 SLLAGGDDDTMSVMSGMSGRGSSSRSKKIKPPTGKRKLPEAEESSSSDSMWLNREQTMNTP 1119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 76/108 (70%)
stag1XP_002931833.2 STAG 169..277 CDD:285686 76/108 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.