DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and LOC100333021

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_009305909.3 Gene:LOC100333021 ID: Length:1105 Species:Danio rerio

Alignment Length:1097 Identity:369/1098 (34%)
Similarity:598/1098 (54%) Gaps:94/1098 (9%)


  Fly    53 KPPIIDDDE-----DDF-FAPIARKRKTPATRKGPTERKERVERPRKEPVDKGHHERIDSEREIT 111
            :|...:||.     .|| |.....|||..:| :|.........||.............|||..::
Zfish     3 EPYSSEDDSISLTGSDFEFQLKTSKRKVNST-QGVASPNRVHRRPASALSSSQSQAPTDSEGGVS 66

  Fly   112 TDENSLYYIVRHSKNPIASIVDQWIEQYKANRETALVALMQFFINASGCKGKISEDIQYPVDHTS 176
            |  ..||..||..::.:.:::|.|:|:|:.::|..|:.|:.|.:..|||||.:|.::...:.:..
Zfish    67 T--AYLYEAVRSGRSALTTVIDDWLEEYQRDKEAGLLELINFVVQCSGCKGVVSREMLSSLQNAD 129

  Fly   177 IIRRMTEEFDEESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLS 241
            ||..:|:||:|:|..|||:.||.|||:|....|:||..||:.|:.:::||.||..:.|:|||||:
Zfish   130 IISHLTKEFNEDSVSYPLVSSGPQWRRFSEGVCEFVCVLVRGCRNTLLYDDFLFSSFIALLTGLA 194

  Fly   242 DSQVRAFRHTATLAAMKLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSE 306
            ||||||||||::..||:||:::|.||..|:.......::.:.|:.|..:.||.|||:.|.....|
Zfish   195 DSQVRAFRHTSSFIAMRLMSSIVSVAADVNIQAQMIQRRSDLEKSKPAEERAIDRLEELEHSYRE 259

  Fly   307 LEENMDEIKSMLTYMFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHD 371
            |.|..::::|::..:||.||||||||.:|:|||:||.|:|:|:...|.:||:|.:|||:||.|||
Zfish   260 LMEQQEDLRSLMNGIFKGVFVHRYRDVIPEIRAVCMEEMGVWLRENPAHFLNDEHLKYVGWMLHD 324

  Fly   372 KIGEVRLRCLQSLLPLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPE 436
            |...|||:|:.:|..|:|:.:...:||.|||:||:||:.|.|||:.:|:|..|||::.|.....:
Zfish   325 KQAAVRLQCVLTLQKLFEEKDFLSRLEFFTSRFKERILCMILDKDSDVAVETVKLLLLIQTQTDD 389

  Fly   437 ILADKDCEIVYELVYSSHRGVAQAAAEFLNVRLFH-LTADMEETKTKRGKVRMPNTPLVRDLVQF 500
            .|:..:...||.||:::|||:|.||..|    |:| |....:::...|      :..::|.|..|
Zfish   390 GLSASERAAVYPLVFATHRGLACAAGRF----LYHTLCCAADQSSDSR------SVSILRLLALF 444

  Fly   501 FIESELHEHGAYLVDSFID-SNDMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQS 564
            ||:||.|:|.||||||..| :...::|||.||.|||::....|::     ||.||:||:.:|:|:
Zfish   445 FIQSEYHDHAAYLVDSLWDVAGAELKDWELMTSLLLQDSSLQEQL-----ESALIDIMMCAVRQA 504

  Fly   565 ATGEVPVGRASNRKCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFD 629
            |....|..||..:..|...|.::| ||:: :::..|:..||.||.|:.||..|::.||..|.:|.
Zfish   505 AEATPPTARAHRKSVTARQKRVQA-QDQR-RISSVFMPVLPQLLAKFSADVGKVSRLLRAPLHFQ 567

  Fly   630 LNLY-TTNRQEGNLQALLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARS---NI 690
            |.:| |:.|.|.:|..||.::..:...|....|||.|.:.|..||:||   ||.|..|.:   .:
Zfish   568 LEVYGTSGRLEKSLDQLLSQVCDITLKHHEECVLEACVRVLCVLCSEG---YTFCGRAETAVGQL 629

  Fly   691 IESAVNKYKDAIEEWRNLIQGEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQ----D 751
            :::.|.|:...:||   ::||  :.:|||:|....:|.:|:|..|:.:|....||:..||    .
Zfish   630 LDTTVEKFTANLEE---ILQG--SADEDDLYRAASSLNILAIFSSARDLTERNLFEFCFQLLKMG 689

  Fly   752 VEEAQSKENIDRCLPNEALVYCIEACYFSISWGL-QYVENECESVNVTEVVAELRNNLDTFMGAC 815
            ||..:..|.:        :|..:..|.:.:.|.. :..:...:......|:..| ::......:|
Zfish   690 VETGEISEKL--------MVPALSCCAYQLLWSAHRNTQRRTDKAEARRVLKSL-HSFCVLCQSC 745

  Fly   816 FELTRDGPTVQIQEAAYQSICDLLIIFSDKLARSEIEHIRGLEYKSRMDEHLILD--NFVQHYVF 878
            ..:...    .::..|:..:||||::|    .|.....|..|: :...||.|..:  :||..|||
Zfish   746 LSIALS----PVRSKAFVCVCDLLLVF----CRPPEGSISPLQ-RFSPDESLRAEMASFVLDYVF 801

  Fly   879 SLKQDVAQDETRIEELHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKA 943
            ..:....:||..:..|.:|||.|:.||||::|.::....|..|.:||.:.|.|:|||||.||.|:
Zfish   802 GDEDLTGEDEEMMTALLQKRNHLSGYCKLIIYGVLELQAATDILRYYHRFYKDFGDIIKETLNKS 866

  Fly   944 REINKVNFAMTLLLSLITVFKSLQEQSEDGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVA 1008
            :.||..:.|.|:.|.|..::..|..|..||       |.::::.|||:.|:.|..:....|:.:.
Zfish   867 KMINSEDSARTVCLCLQQLYAGLDLQCCDG-------ELMEIRLLAKKLAMNFSINLRLVRKPLL 924

  Fly  1009 AIHRGGIYFAA-NKEPDDPVRAPTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAE 1072
            ::|:.||.||: ..|..:.:    .|.|||:|:||::|||:.::|.::..|.::....:.:|...
Zfish   925 SLHQDGIRFASQGLEKGEAM----NLQFLEILSEFSFKLLQPERKQLLMILRRVCSSVLNNSSVR 985

  Fly  1073 EWQPLILYRNSLLHG-----ETDQAPVASKRAYTRKRRDHDEEEEEEEDEEEHNDPD 1124
                  :|..||..|     :|.:|||      :::||.|..|.........|:..|
Zfish   986 ------MYERSLNSGSKETAKTSEAPV------SKRRRTHSLETPAVISHTHHDTDD 1030

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 50/108 (46%)
LOC100333021XP_009305909.3 STAG 143..240 CDD:312124 44/97 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.