DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and stag1

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_001121432.1 Gene:stag1 ID: Length:1265 Species:Xenopus tropicalis

Alignment Length:1190 Identity:524/1191 (44%)
Similarity:727/1191 (61%) Gaps:121/1191 (10%)


  Fly    12 MDDPPPDYEELHSDALNESTSDADSPTKRMTRLRARG----GVRDKPPIIDDDEDDFFAPIARKR 72
            :.|...:...:|:|....||   |..|:.:..|..:|    |...:||          :.|.:.|
 Frog     9 LQDSTNETAVVHTDMSAVST---DMSTELVEDLEVKGKRKRGRPGRPP----------SAIKKPR 60

  Fly    73 KTPATRKGPTERKERVERPRKEPVDKGHHERIDSEREITTDENSLYYIVRHSKNPIASIVDQWIE 137
            ||||.|    .|.|...|.|...  .||.::......:|     |:.:|:..|:.:.|:||.|||
 Frog    61 KTPADR----SRAETGSRGRGRA--NGHPQQNGEGDPVT-----LFEVVKMGKSAMQSVVDDWIE 114

  Fly   138 QYKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRMTEEFDEESGEYPLIMSGTQWR 202
            .||.:|:.||:.|:.|||..|||||.:..::...:.:..|||:|||||||:||:|||.|.|..|:
 Frog   115 SYKQDRDIALLDLINFFIQCSGCKGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPHWK 179

  Fly   203 KFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVRAFRHTATLAAMKLMTALVDVA 267
            ||:.|||:|:..|::|||||||||:::||.|||||||||||||||||||:||||||||||||:||
 Frog   180 KFRCNFCEFISVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVA 244

  Fly   268 LLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENMDEIKSMLTYMFKSVFVHRYRD 332
            |.:|.:.||..:|:||||.|...:||::||:.|:.||.||:||.|||::|:..:||.:|||||||
 Frog   245 LNLSIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRYRD 309

  Fly   333 SLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEVRLRCLQSLLPLYEKDELKGKL 397
            ::.:|||||:.|||:||:.|...||:||||||:||||||:.|||||:||::|..||...||..||
 Frog   310 AIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTNRELFPKL 374

  Fly   398 ELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADKDCEIVYELVYSSHRGVAQAAA 462
            ||||::||||||:||||||::|:|.|::||..||....|.|:::|||.||.||||:||.||.||.
 Frog   375 ELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLVYSAHRPVAVAAG 439

  Fly   463 EFLNVRLF--HLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESELHEHGAYLVDSFIDSN-DMV 524
            |||:.:||  | ....||...||.....||..||:.||.||:|||||||.||||||..:|: :::
 Frog   440 EFLHKKLFSRH-DPQAEEALAKRRGRSSPNGNLVKMLVLFFLESELHEHAAYLVDSLWESSQELL 503

  Fly   525 RDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEVPVGRASNRKCTLSAKELKAI 589
            :||||||:||:|||...|||:..:|||.|||:||.:::|:|....||||.:.:: .|:|||.|..
 Frog   504 KDWECMTELLVEEPMQGEEVMSERQESALIELMVCTIRQAAEAHPPVGRGTGKR-VLTAKERKTQ 567

  Fly   590 QDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYTTNRQEGNLQALLDRINQVMS 654
            .|:|.||||||||.||.||.||.||:||:||||.:||||||.||:|.|.|.:|.:||.:|..|:.
 Frog   568 LDDKNKLTEHFIVALPVLLSKYSADAEKVANLLQIPQYFDLELYSTGRMEKHLDSLLKQIRFVVE 632

  Fly   655 MHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYKDAIEEWRNLIQGEETPNEDD 719
            .|...:|||.|:||...||:|......|..||.|.:|:...:::..|:||   |:|..|..:||:
 Frog   633 KHIESDVLEACSKTYSILCSEEYTIQNRVEIAHSQLIDELADRFSHAVEE---LLQEAEEADEDE 694

  Fly   720 IYNITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDRCLPNEALVYCIEACYFSISWG 784
            |||:..:||.|:..:::|:|..||||.|.::.:......|.    :..:.:|..::..::||.|.
 Frog   695 IYNVMASLKRLTCFHNAHDLTKWELFVSCYRLLRAGIEHEG----MMEQIVVQALQCSHYSILWQ 755

  Fly   785 LQYVENECESVNVT------EVVAELRNNLDTFMGACFELTRDGPTVQIQEAAYQSICDLLIIFS 843
            |         |.:|      |.:..||..:.||:..|.:.. ...|..::|.|:..:||||:|||
 Frog   756 L---------VKITEGNPSKEEMLTLRKTVKTFLAVCQQYL-SSVTTTVKEQAFMLLCDLLMIFS 810

  Fly   844 DKLARSEIEHIRGLEYKSRMDEHLILDNFVQHYVF--------SLKQDVAQDETRIEELHKKRNF 900
            .:|.....|::..|.:...:.....|.|||..:||        |::.|...:..:||.|||:||.
 Frog   811 HQLTTGGRENLVLLVFNPDVGLQSELLNFVMDHVFIDQDDENQSMEGDEEDEANKIEALHKRRNL 875

  Fly   901 LACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLSLITVFKS 965
            ||.:|||::|:|:....||.|||:|:|.|||||||||.||.|.|:::|:..|.||:|||..:|..
 Frog   876 LAAFCKLIIYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQMDKIQCAKTLILSLQQLFNE 940

  Fly   966 L-QEQSEDGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFAAN-KEPDDPVR 1028
            | |||..:  :.::|.....:||||:|||||||.|.||.||:||.:|:.||.||.. :.|.....
 Frog   941 LVQEQGPN--LDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNPKGQEY 1003

  Fly  1029 APTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEEWQPLILYRNSLLHGETDQ-- 1091
            .|..|.|||||:||:.|||:||||.:.|:|:|.:...|...|.:.|.|||.|||||:.|..:.  
 Frog  1004 PPLNLAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTDQMMERREDVWLPLISYRNSLVTGGDEDRL 1068

  Fly  1092 -----------APVASK--RAYTRKRRDHDEE--------------------------------- 1110
                       :.|.||  |....|:|..:||                                 
 Frog  1069 SVNSGGSNSKGSSVRSKKGRPPLHKKRGIEEESIDNSWVTRNDTMQTPGALTTPQLTSTVLRENP 1133

  Fly  1111 ----EEEEEDEEEH-NDPDY 1125
                |:..|.|.|| ::||:
 Frog  1134 RQLPEQIPEQESEHSSEPDF 1153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 72/108 (67%)
stag1NP_001121432.1 STAG 167..275 CDD:285686 72/108 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62906581
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H21191
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.