DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SA and stag3

Sequence 1:NP_477268.2 Gene:SA FlyBaseID:FBgn0020616 Length:1127 Species:Drosophila melanogaster
Sequence 2:XP_012808812.1 Gene:stag3 XenbaseID:XB-GENE-995439 Length:1253 Species:Xenopus tropicalis

Alignment Length:1190 Identity:435/1191 (37%)
Similarity:671/1191 (56%) Gaps:116/1191 (10%)


  Fly     1 MMARRGGKRIRMDDPPPDYE----ELHSDALNESTSDADSPTKRMTRLRARGGVRDKPPIID--- 58
            :|:..|...|. ..|.|.|.    |..:..|..|:..::.|..::.  ..:.|:.:.|.::|   
 Frog    11 VMSAHGSSSIE-SSPHPKYSGSSPEGGAPYLTPSSVASEGPVSQLA--SEQRGLDETPTVLDIVT 72

  Fly    59 -------DDEDDFFAPIARKRKTPATRKGPTERKERVERPRKEPVDKGHHERIDSEREITTDENS 116
                   |:..||...::::.:    |..|.| ....:|||              ..|.|.....
 Frog    73 ETDESISDEGSDFEETLSKRPR----RASPGE-TVAAKRPR--------------IAEETVCAKD 118

  Fly   117 LYYIVRHSKNPIASIVDQWIEQYKANRETALVALMQFFINASGCKGKISEDIQYPVDHTSIIRRM 181
            |:..:|..::.:..:||.|::.||.:||.||:.|:.|.:.|.||.|.::.::...:.::.|||:|
 Frog   119 LFEAIRMGRSAMHVLVDDWLDSYKQDREAALLELINFLMLACGCNGVVTLEMLENMQNSDIIRKM 183

  Fly   182 TEEFDEESGEYPLIMSGTQWRKFKNNFCDFVQTLVKQCQYSIIYDQFLMDNVISLLTGLSDSQVR 246
            |.||:||:.:|||::|...|:||..||.||.:.||.:|||:||||:.|||.:|||||||||||||
 Frog   184 TMEFNEETPDYPLLLSTKPWKKFHANFGDFFKVLVNRCQYNIIYDELLMDALISLLTGLSDSQVR 248

  Fly   247 AFRHTATLAAMKLMTALVDVALLVSNNFDNAAKQFEAERVKSRDRRASDRLDSLMTKRSELEENM 311
            |||||:|.||:|||:.||.||..||::.:...:||..|..||.:.|:.:||::|:.|:..|:.|:
 Frog   249 AFRHTSTFAAVKLMSGLVKVAWDVSHHLNTTKRQFVVEHAKSPETRSPERLEALLAKQRGLQGNL 313

  Fly   312 DEIKSMLTYMFKSVFVHRYRDSLPDIRAICMAEIGIWMENYPQNFLDDSYLKYIGWTLHDKIGEV 376
            :|:..|:..:||.||||||.|:..|||||||.|||:||..|.|:||.||.|||:||||:||.|.|
 Frog   314 EEVVDMMNGIFKGVFVHRYCDTSADIRAICMEEIGVWMRTYSQSFLSDSCLKYVGWTLYDKQGAV 378

  Fly   377 RLRCLQSLLPLYEKDELKGKLELFTSKFKDRIVAMTLDKEFEVSVHAVKLVISILKIHPEILADK 441
            ||:|:::|..||...|:..|||||||:||:|:|.|.||||.:|:|.|:||:..|.:...::|:.|
 Frog   379 RLQCIRTLHSLYSVPEMAPKLELFTSRFKNRMVFMVLDKEQQVAVEAIKLIGLISQNMEDMLSKK 443

  Fly   442 DCEIVYELVYSSHRGVAQAAAEFLNVR-LFHLTADMEETKTKRGKVRMPNTPLVRDLVQFFIESE 505
            ||:.:|..|:.|.|.|:.||..||..| |.|..|   ||..| |:.|:.|....|.|:.|||:|:
 Frog   444 DCDTIYPFVFVSSRAVSSAAGAFLYQRVLAHTVA---ETSPK-GRNRLGNVSFFRLLMSFFIKSK 504

  Fly   506 LHEHGAYLVDSFID-SNDMVRDWECMTDLLLEEPGPNEEVLDNKQESTLIEIMVSSVKQSATGEV 569
            |.||.||||||..: :...::||.|.|||||.|    ||.||:..||.||||:|:|::|:..|..
 Frog   505 LPEHAAYLVDSLWECAGAPLQDWVCQTDLLLLE----EEGLDDADESALIEILVASMRQAVEGTS 565

  Fly   570 PVGRASNRKCTLSAKELKAIQDEKAKLTEHFIVTLPSLLEKYQADSEKLANLLAVPQYFDLNLYT 634
            ||||...|: ..:.|:.||  ::|::||.|.|:.||.||.|:.|||:|:..||.:..:.:|.:|.
 Frog   566 PVGRVPARR-AFALKDRKA--EDKSRLTRHMILALPPLLAKFSADSKKVRTLLKITSFMELEIYC 627

  Fly   635 TNRQEGNLQALLDRINQVMSMHTGREVLETCAKTLECLCAEGSATYTRCNIARSNIIESAVNKYK 699
            |:|.|..|..||..:.:::..||..:|||:|::.|..||....|.|.|.:||||.:::....::.
 Frog   628 TDRMEKFLDMLLAEVQEILEKHTEEDVLESCSRALYILCDRKQALYQRADIARSTLMDRLTGRFL 692

  Fly   700 DAIEEWRNLIQGEETPNEDDIYNITITLKVLSILYSSHNLNPWELFKSLFQDVEEAQSKENIDRC 764
            ..:.|    |..|..|:||.:|||..|:|.:|.|||.|:|:.||||....|.:.:......:   
 Frog   693 QQVPE----IMQETEPDEDAVYNIAATMKRISPLYSGHDLSRWELFGPCSQILLKGMDTGEV--- 750

  Fly   765 LPNEALVYCIEACYFSISWGLQYVENECESVN-VTEVVAELRNNLDTFMGACFELTRDGPTVQIQ 828
             |.:.::..:.:|:||:.|.|.::.|.....| ::.:..:||...|...|...:|     ...|:
 Frog   751 -PEQIVMAALTSCHFSLLWELFHISNSKGPQNQISPLKQKLRQFCDICQGCLSDL-----NAAIR 809

  Fly   829 EAAYQSICDLLIIFSDKLARSEIEHIRGLEYKSRMDEHLILDNFVQHYVFSLKQDVAQDETRIEE 893
            :.|:..:.|||:||...:|:.:..:::.|.|:..:.....|..|:...||:..:: ..:..|.|.
 Frog   810 KQAFVLLSDLLVIFGSPIAQEQRFYLQPLAYRPSLSLQAELAGFLLDNVFTDPEE-ENEARRTET 873

  Fly   894 LHKKRNFLACYCKLVVYNIIPTMRAASIFKYYVKCYNDYGDIIKATLGKAREINKVNFAMTLLLS 958
            ||::||.||.||||::|:.:....|:.||::|||....|||:||.||.|.|.|::.....|:|||
 Frog   874 LHERRNLLAGYCKLILYSSLQLHSASDIFRHYVKFNASYGDLIKETLHKCRSISREETTKTVLLS 938

  Fly   959 LITVFKSLQEQSEDGIVSKSSQEFVDLKELAKRFALTFGFDAIKNRESVAAIHRGGIYFA--ANK 1021
            |...|..|.::. |....:||:.|::::.||:|.||.:|.|..:.|:.:..:|:.||.:.  .||
 Frog   939 LTQAFTELCQEG-DSPPQRSSRPFLEIRGLARRLALLYGPDQRRYRQDIVLLHKEGIKYCLRENK 1002

  Fly  1022 EPDDPVRAPTRLLFLEVLNEFNYKLLKQDKKVIMSFLDKIIPPAMPSSRAEE---WQPLILYRNS 1083
            ..|   .:|..||||:||:||::|.:|:|||.::.:|::.....:||...::   |.|.:.||.|
 Frog  1003 TSD---WSPQNLLFLDVLSEFSHKTIKEDKKALLRYLEETTERCLPSQPVKDNEIWAPFLAYRKS 1064

  Fly  1084 LL-------HGETDQAP--VASKRAYTR-------KRR--------------------------- 1105
            |.       ..|:|.:|  |.:||:..|       |||                           
 Frog  1065 LCADEESPPSTESDVSPRRVGTKRSTPRPEVPPQSKRRRGSIGTLDISSLMIEEGKPRLPLMTST 1129

  Fly  1106 DHDEEEEEEEDEEEHNDPDY 1125
            ...|::.....|||.::.||
 Frog  1130 QLKEQKTRTLQEEERSETDY 1149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SANP_477268.2 STAG 190..298 CDD:285686 61/108 (56%)
stag3XP_012808812.1 IRR1 29..>428 CDD:227824 176/420 (42%)
STAG 193..300 CDD:285686 61/107 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62889492
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.