DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18304 and Pif1A

Sequence 1:NP_001260170.1 Gene:CG18304 FlyBaseID:FBgn0031869 Length:1901 Species:Drosophila melanogaster
Sequence 2:NP_001189195.2 Gene:Pif1A FlyBaseID:FBgn0261015 Length:1264 Species:Drosophila melanogaster

Alignment Length:1415 Identity:278/1416 (20%)
Similarity:507/1416 (36%) Gaps:423/1416 (30%)


  Fly   268 TTASSSNSSSTSLKTSNSTSASNEVKVVTSTSSSSTSSSSVRRKEAD-----SVASKEIKRQTVP 327
            |..:||...:|..:|::..:..|.. ||..|...|....|...::.|     ::|..::||:.  
  Fly     6 TKTTSSKGCNTMSRTAHILAPHNGT-VVRRTDPGSKLKESFHTEKHDIEDWQTMAKNKLKRKK-- 67

  Fly   328 AASISHSNSTSSTASTASKSQDT--NGMQEQMKALKLELETMKTRAEKA--------------ER 376
                ..|:|.:|...|.::.:.|  .|:|...:......||....|||.              :|
  Fly    68 ----KLSSSLTSVGDTVNQEKRTRIEGIQLHCRGKLRPKETQSFEAEKGPSAGSQKQLGKAEKDR 128

  Fly   377 EKSDI----------------LLRRL-ASMDTASNRTAASEALNLQQKLNEMKEQLDRVTE---- 420
            |:..|                :.|:| .:|||.....|.:|.|.|:  :||:|..|  :||    
  Fly   129 ERPVIIGGVTTTNVIAAPPQRIKRKLQENMDTIQKLNALTEQLRLE--VNELKSSL--ITERGAV 189

  Fly   421 ---------DKRKLNLRMKELENKGSESELRRKLQAAEQICEELMEENQS-------AKKEILNL 469
                     |.|:....:|:|::   ..|:.:|....::..|...|.:.:       ...||..|
  Fly   190 RALRAQNDADSRRWKSEVKKLQH---TLEMAKKSNGIKKAIESGPESSGAHVTADGLINYEIQRL 251

  Fly   470 QAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSD-RKIETLEQERQSSFNAELSN 533
            ..|:..:::..|:.|.|.:...|.|             :||.:| |:::...:.|.:........
  Fly   252 TNEIAVLKEANRNKEEKTQIMGQAD-------------RLKAADMRQLKNAYENRLTHIQKSAKI 303

  Fly   534 KIKKLEEELRFSNELTRKLQAEAEELRNPGKKKAPMLGVLGKSTSADAKFTRESLTRGGSQEDPQ 598
            :|.:|.||::.......:|:.:...|::|.|.|           ..:||....:..:....|..|
  Fly   304 EITRLLEEIKTKERNIGQLRKDLLALQSPKKLK-----------QNEAKVPATTKPKTNPNETSQ 357

  Fly   599 HLQR-------ELQDSIERETDLKDQLKFAEEELQRLRDRERKRVRFSCGTQTEVPLEVVAFPRG 656
            ..::       |.:...|.:||....              |:..:|.:..|.....|:.:.....
  Fly   358 KPKKPTTKAAGETKAKTEPDTDTDIS--------------EQNPIRQAQVTPEITQLKNIELINN 408

  Fly   657 TQTVATVQSDMSTSVENLVTSNVAVTQTDFEVPDRNVSIERETMSSPFAGLFPPSSSSRVGQSGS 721
            |:.......:|.|::::...:.:....|....||   .:...|..:...|....|.|........
  Fly   409 TKNAHKSALEMRTTMKSSQPNGLDDAPTRMRAPD---EMRATTWMTTLVGSNCHSHSHSHPAVAK 470

  Fly   722 LLFPSAISHVLLSGAGRKLSPTPHPHRLAPEVHADRDEGISDEDDPAELRILLELNEQEASILRL 786
            ...|::.:...||.|...:||.|      |...:|                        :.::..
  Fly   471 SKDPNSDTDSALSSAPPSISPQP------PSSGSD------------------------SGVIWQ 505

  Fly   787 KVEDLEKENAESKKYVRE---LQAK---LRQDSSNGSKSSLLSLGTSSSAAEKKVKTLNEELVQL 845
            .::||:|...|::.|.:|   ||.:   ::|:.....|:::       |.|:|:.     ::.:|
  Fly   506 TLQDLDKLQKEAEMYQKENERLQTEVQLMKQELDAAEKAAI-------SRAKKQA-----QIGEL 558

  Fly   846 RRTLTEKEQTVDSLKNQLSKLDTLETENDKLAKENKRLLALRKASEKTGEV----DQKMKESLAQ 906
            .:.:.|.|:...||:::.|:   |..:|:.|   ..|:|.|...|:|....    .|.:::.|.|
  Fly   559 MQRIKELEEMQSSLEDEASE---LREQNELL---EFRILELEDDSDKMESTCEGHCQSLQDLLEQ 617

  Fly   907 -AQRERDELTARLKRM-----QLEAEDKLP-----PRTAKRVNDLTPKSHLKKWVEELEDEISEM 960
             |||..|.....|:::     ||:.:..:|     ..|.||.|.....||.....:.....|...
  Fly   618 SAQRLEDRDKRCLQQLLQCVQQLDLDTMMPGDQNRTETPKRHNSTHSHSHSHSHSQSHNHRIVAT 682

  Fly   961 RVMLSSSGTDQLKALQSAKGALEEDLRKCK-----QKLSLAEGDV-------------------- 1000
            ....|:..|.......|.        |.|.     |..||:|..|                    
  Fly   683 VQPYSNCATPTAPPTPSK--------RHCNQVSSWQSSSLSESGVFVECDLLSNPNPIGHPHLQF 739

  Fly  1001 --QRLKLLNG--------SSSKVSELEQKLKRGDEEAKKLNSKLKDLEDKVK---KQEAQLKLGE 1052
              :||:.|.|        ..::...|.|:|:|    ..:|...||:|.|:|:   :|.|||   |
  Fly   740 YQERLEQLEGKLLIYESSGETQARHLAQRLQR----ELQLEKDLKELADRVELLIEQNAQL---E 797

  Fly  1053 TSKSTWESQSKREKEKLSSLEKDMEKQAKE-------KEKLEAKISQLDAELLSAKKSAEKSKSS 1110
            .:|..:|......:..|...|.::|...:.       ||.|.||.....||:|..::....:::.
  Fly   798 EAKCEFEEAENDTRLHLQRNEVELEILRQRNVELEFGKEALGAKYQDCRAEVLILREDLAAAETQ 862

  Fly  1111 LE----------KEIKDLKT--------------------------------------------- 1120
            ||          ||::||:.                                             
  Fly   863 LEHLQAERKQARKELQDLRRSLPLLLIFRLLSLAKMGNEESSPGGSPRLSSGYTSSIHQDRDFSA 927

  Fly  1121 ----------KASKSDS---KQVQDLKKQVEEVQASLSAEQKRY----EDLNNHWEKLSEETILM 1168
                      :|..:||   :::..||::|:.:::.|.....|:    |..::||..|.:     
  Fly   928 KIQTTEFDLGQAGFTDSGEEREIVYLKEEVKSLRSQLKELNARHYEAMETADSHWVDLEQ----- 987

  Fly  1169 RAQLTTEKQSLQAELNASKQKIAEM-DTIRIERTDMARKLSEAQKRIADLQA---------KALK 1223
              |....:::.||:..:.|||||:: |.:|.:......|:.:.::....|::         :.|.
  Fly   988 --QYKEREEAQQAKEASLKQKIAQLQDCLREDSRAATEKIQQLEEGELSLKSCLVRMTKEHRDLL 1050

  Fly  1224 TVNGNGAEYERTV---LKNKLA--EKEHEY--------ERLRRENE-MNIDLVF----------Q 1264
            |.|       ||:   |::.:|  |||.|:        |..||:.: :..||:|          |
  Fly  1051 TEN-------RTLQCSLESLMAKMEKEAEHKMPLTEALENERRKTQALMDDLIFAKKVQQNTEDQ 1108

  Fly  1265 LRKDNDDLNGKL----SDYNRIEQAQSSLNGHGARREAEIRELKEQLQSTELQMKSEVATVRLRY 1325
            ||::.|.|..::    .||..||.....|.......|.:||:::.|::.:               
  Fly  1109 LRQETDALRTQIFNIKKDYLHIEVTNGELKEEVGTLENKIRQMENQMRDS--------------- 1158

  Fly  1326 EQQVKNLSGELTSMQRQCE-------------------------RFKKDRDAFKQMLEVAQKKIG 1365
            |::.:.|..||.:...||:                         |.|||.   ...|:.|.:.:|
  Fly  1159 EERARCLEDELRTKDEQCQLLERKLGVMPEGYSLADELHDSPAKRAKKDE---VPSLQAASQGLG 1220

  Fly  1366 DLKANNTGRQSRGSMHSSDDDDKSKIAYLEQQIGHLEDQLVESRLESSKI 1415
            ....:..||.....:|.    |...||...:|:.  :..|.:|..|::::
  Fly  1221 VALLDLEGRDFGLPLHK----DFQAIACSVKQLA--DTLLSQSPSENARL 1264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18304NP_001260170.1 Smc 404..1202 CDD:224117 184/965 (19%)
CENP-F_N 1012..1286 CDD:287456 84/394 (21%)
ATP-synt_B <1180..1231 CDD:304375 14/61 (23%)
LCD1 1485..>1594 CDD:286837
Pif1ANP_001189195.2 JAKMIP_CC3 <156..282 CDD:292653 32/146 (22%)
JAKMIP_CC3 <516..595 CDD:292653 22/97 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43939
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.