DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18304 and soga1

Sequence 1:NP_001260170.1 Gene:CG18304 FlyBaseID:FBgn0031869 Length:1901 Species:Drosophila melanogaster
Sequence 2:XP_005162024.2 Gene:soga1 ZFINID:ZDB-GENE-090313-188 Length:1793 Species:Danio rerio

Alignment Length:1974 Identity:412/1975 (21%)
Similarity:717/1975 (36%) Gaps:576/1975 (29%)


  Fly    73 LTSANATNGNDIVVHF--NVELRKRPQSWASTPDIDEPD---NVARRPPATASTSRAASSAEDQD 132
            :|......|:.  .||  :.|.|::.:..:||.::::|.   ...::||                
Zfish     1 MTKTKVDTGSP--THFVSSKEKRQKQKMESSTGELEQPQPQHQPTQQPP---------------- 47

  Fly   133 VAVTVKLPVPPRRHTTALDIKEVEHAITPPTRVTSSPSKTSSIPDELVILSTDSLAERVRKMNLL 197
                   |.||.:.|.    |:..|....|.|           |.::...|...:...:....|.
Zfish    48 -------PAPPLQVTE----KKKIHRAPSPAR-----------PKDVAGWSLTKIRGGIGTPTLS 90

  Fly   198 KKQRS--LNSRENSRERSVPRREEESESTATPTPVVPDRPERSKSGTSLNQLAQAEQKRAALPPK 260
            .|..:  |..|. ||...|..::.::|.. .||    .:|..|.:|...:.:...:..|     :
Zfish    91 VKPGAIYLGGRV-SRRSPVTGKDAKTEKN-KPT----GKPALSATGAQKSSVKSNKSGR-----R 144

  Fly   261 KVAVASTTTASSSNSSSTS---LKTSNSTS-----ASNEVKVVTSTSSSSTSSSSVRRKEADSVA 317
            ||:.||..:...|..|..:   |..::|:|     ||.|.||.|...||.|.:||....:.|..|
Zfish   145 KVSDASIGSDDLSKDSGCAPGKLSPTDSSSELSDCASEENKVSTDALSSDTETSSRGGIDGDKAA 209

  Fly   318 SKEIKRQTVPAASISHSNSTSSTASTASKSQDTNGMQEQMKALKLELETMKTRAEKAEREKSDIL 382
            ::.        ..:..|..|.::|              :.:.|.|.:||.:......|.      
Zfish   210 AEH--------GLLDKSGHTKTSA--------------EKERLSLGMETAEGSVSPGEE------ 246

  Fly   383 LRRLASMDTASNRTAASEALNLQQKLNEMKEQLDRVTEDKRKLNLRMKELENKGSESELRRKLQA 447
             |.|.|||   :|..||.:|.......|:.:                      |...||.|::  
Zfish   247 -RSLTSMD---SRMPASTSLAFSDLTEELMD----------------------GMNEELVREI-- 283

  Fly   448 AEQICEELMEENQSAKKEILNLQAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKS 512
                 |||..||...|.|:..|::||.|::|.:.:::|.....|::.|::|.|.||||.::|||:
Zfish   284 -----EELRSENDYLKDEMEELRSEMLEMRDMYLEEDVYQLQELRQQLDQANKTCRILQYRLKKA 343

  Fly   513 DRK--------------IETLEQERQSSFNAELSNKIKKLEEELRFSNELTRKLQAEAEELRNPG 563
            :|:              |.||||:.:.:.:..:     :|..||....:...:|:.|.||||   
Zfish   344 ERRSIRVAQTGQVDGELIRTLEQDVKVAKDVSI-----RLHNELDTVEKKRSRLEQENEELR--- 400

  Fly   564 KKKAPMLGVLGKSTSADAKFTRE-SLTRGGSQEDPQHLQRELQDSIERETDLKDQLKFAEEELQR 627
             .|...|.|..:...|:.:..|| ||.:..::.:.:..::......|..:|||.||.||:||   
Zfish   401 -VKLQDLEVAKQVLQAEMEKARENSLKKRSARPNNKPDKKASPQPPEDSSDLKCQLHFAKEE--- 461

  Fly   628 LRDRERKRVRFSCGTQTEVPLEVVAFPRGTQTVATVQSDMSTSVENLVTSNVAVTQTDFEVPDRN 692
                                                .:.|...:..:|..|.|:           
Zfish   462 ------------------------------------SALMCKKLTKMVKDNEAM----------- 479

  Fly   693 VSIERETMSSPFAGLFPPSSSSRVGQSGSLLFPSAISHVLLSGAGRKLSPTPHPHRLAPEVHADR 757
                ||.::.                     |.|....|..|....:::.:||...         
Zfish   480 ----REELAK---------------------FRSMYGEVDASLTVEEVADSPHTRE--------- 510

  Fly   758 DEGISDEDDPAELRILLELNEQEASILRLKVEDLEKENAESKKYVRELQAKLR----QDSSNGSK 818
                      ||:::.|:|.|:||::|..::.:||.||       |.|:|::.    |||..|  
Zfish   511 ----------AEVKVHLKLVEEEANLLSRRIVELEVEN-------RGLRAEMDDMKIQDSPGG-- 556

  Fly   819 SSLLSLGTSSSAAEKKVKTLNEELVQLRRTLTEKEQTVDSLKNQLSKLDTLETENDKLAKENKRL 883
                 :|.:.......:.:.:|.:::|:|.|...|:..|.|:..|.:::          ::||.|
Zfish   557 -----IGITGGVGSHLLFSTSENVMELQRHLQFVEEEADLLRRSLIEME----------EQNKLL 606

  Fly   884 LALRKASEKTGEVDQKMKESLAQAQRERDELTARLKRMQLEAEDKLPPRTAKRVNDLTPKSHL-- 946
            :         .|::....|..|..:.|....:..:....:     ||..:...:|:.|.|..|  
Zfish   607 M---------NELNHYKSELPAVTEIEPSSSSTTITSPTI-----LPGPSEDALNEATHKELLAA 657

  Fly   947 KKWVEELEDEIS----EMRVMLSSSGTDQLKALQ-SAKGALEEDLR-----KCKQKLSLAEGDVQ 1001
            :..:.||..::.    |.||:||:.....|.:.| ||:.:||.|..     :|....:..||.| 
Zfish   658 RLQIAELNGKVKKLQYENRVLLSNLQRCDLASNQGSARPSLETDAEAGDSAECIPSHTHREGPV- 721

  Fly  1002 RLKLLNGSSSKVSELEQKLKRGDEEAKKLNSKLKDLEDKVKKQEAQLKLGETSKSTWESQSKREK 1066
                                 |||:...|             :|..||:..|| .|..||....|
Zfish   722 ---------------------GDEQTDIL-------------EEKNLKVSRTS-HTHTSQCLSVK 751

  Fly  1067 EKLSSLEKDMEKQAKEKEKLEAKISQL----DAELLSAKKSAEK--SKSSLEKEIKDLKTKASKS 1125
            :.|:         .:::.:|.....||    |...:|......|  :..|.|..:.: |::...|
Zfish   752 DLLA---------IRDQAQLVTSAIQLLTSPDTSCISPDSVYRKITANDSAEPVLLE-KSQTPSS 806

  Fly  1126 DSKQVQDLKKQVEEVQASLSAEQKRYEDLN-----NHWEKLSEETILMRAQLTTEK----QSLQA 1181
            ....|:.|..:::.:||.|.|..:|.:.|:     :.::.:|:..:|..|:..|..    ...|.
Zfish   807 TLPVVEVLHGRLQFLQAQLQALSERVDALDEPAVRDCFDGMSQMPLLSEAEDPTANCLCPADAQF 871

  Fly  1182 ELNASKQKIAEMDTIRIERTDMARKLSEAQKRIADLQAKALKTVNGNGAEYERTVLKNK----LA 1242
            .|||::||....|     :.|...|:...:   ||.::...|..|.:    |.:.||:.    |.
Zfish   872 NLNAAQQKPDSRD-----QPDCEVKVHLCK---ADEESNCHKDSNKD----EESDLKDTNSDLLT 924

  Fly  1243 EKEHEYERLRRENEMNI----DLVFQLRKDNDDLNGKLSDYNRIEQAQSSLNGHGARREAEIREL 1303
            |:.||...|..|.....    :.:.|.|.:      :.||.:::.|.|........||:.:::.|
Zfish   925 EQVHELHALLSEAREKAHGAQEALSQERHE------RHSDIHKLSQLQEEHQKALLRRDFQLQSL 983

  Fly  1304 KEQLQSTELQMK--SEVATVRLRYEQQVKN----LSGELTSMQRQCERFKKDRDAFKQMLEVAQK 1362
            ..|   |.||.|  |:...:.::..||:|.    :|.:|..:.:|....||.....|.:|||...
Zfish   984 SLQ---TRLQQKLWSQERNLLVQESQQLKESLLLISLKLRWLLKQWRLGKKLDTESKDILEVNSV 1045

  Fly  1363 K-------------IGDLK--------ANNTGRQ---SRGSMHSSDDDDKSKIAYLEQQIGHLED 1403
            |             .||.|        .|.|.::   ...|:........|.::.|:..:..|..
Zfish  1046 KDLRILLEEDLSSHYGDNKMSAAEEPQLNPTPKEHNLPEKSISQQPSGFGSTLSDLKVALQDLSG 1110

  Fly  1404 QLVESRLESSKIKTELVSERSANEIKISEMQSKLNEFEEERVIGSGSTKLPGMKTKLEL--SWQK 1466
            :|.|.|..|.::..:....:::.|::..|::|.:.:.|.:  :|..|..: |.|...:|  :.:|
Zfish  1111 ELREERQSSQELTQQFARAKASWEVERMELKSIITQLEGK--LGKASVAV-GEKDSSDLKEALKK 1172

  Fly  1467 EREDQQRLLQETSTLARDLRQTLFEVERERDKERLESKRKLDQIKRATEEEMEEGRKKIAELQCD 1531
            |||:.|.||.::.....||.:.|...|:...:||||.....:|.:...::.:.:.:.|.|:...|
Zfish  1173 EREEHQHLLADSYAAVMDLTKQLQISEKNWSRERLELLEHFNQERSQWDQRVRDAQSKGAQSLHD 1237

  Fly  1532 LLELRDVHAKLRTSNEKLRRERERYEKELIKRRMEADGGDRKVGALLQTVDELVK---------- 1586
            ....::..|.:...:..::|.:.......:|..::       ...||.:...:|:          
Zfish  1238 KTSEKEALADVVAGSSAMQRTKSISPLTELKSLLD-------TSLLLHSHKVIVEPECAMAQHQS 1295

  Fly  1587 ----------------------IAPDLKIVGSGG--------SARSSSS-SGYDKN--------L 1612
                                  :..|..|:..|.        |..|:|| .|.:.|        .
Zfish  1296 AAPASILARTDLSDLNNKNWKYLTSDSAILEKGDQFKTWDCPSTNSNSSFPGLELNKEYIQRSYT 1360

  Fly  1613 RPEQPNVRRSRSPSPTLSSSQITSVLARLAEASEELRKFQR--VNEDEQERSRMRRSNLRRAASQ 1675
            .|::..:|...|| ||                   :|:.:|  |.|:.|:..:...|: |.||. 
Zfish  1361 APDKTGIRIYYSP-PT-------------------VRRMERRPVKENTQQDYQQGLSS-RDAAM- 1403

  Fly  1676 ENDPHGSTSSVA--------------SAAGSQRGG---GRLSRNSSNNGSLIRKSLSLDHSIQRD 1723
             .||.|..::.|              |:...|...   ||...::..:|..|..:||        
Zfish  1404 -IDPSGQIAASAPLLTTSPSAYEQWLSSLSQQHRDLLEGRTGGSAPFHGLEISGNLS-------- 1459

  Fly  1724 QNIWRQDDGSVSSMQSIDSELGGLVRDSSLDSRLDSRLSGGST------------------QSDI 1770
                  ||     |:.:.:.:...:|.|||: |..|:.:|..|                  |:|:
Zfish  1460 ------DD-----MKEMTNCVRQAIRSSSLE-RKCSKDTGSQTVGVCSTGTQTAQFVSIGMQTDV 1512

  Fly  1771 PRGPRKKKKGIMGKLRSLTKS-------SRNSESEISIQGSDSDISVASDMRSSKKDLR--GRLS 1826
               |....:|:.||..|...|       ||...|.:....|..|....|....|.|..|  ...|
Zfish  1513 ---PISTARGLQGKAWSPRPSTSLASARSRQISSSLDKVHSRIDRPCCSPKYGSPKLTRRVSTSS 1574

  Fly  1827 GMFKRSGSASRSESM----ERAGS 1846
            ...:.|.::||..|:    .|.||
Zfish  1575 SKLETSSTSSRDRSVWNLHNRTGS 1598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18304NP_001260170.1 Smc 404..1202 CDD:224117 176/844 (21%)
CENP-F_N 1012..1286 CDD:287456 63/297 (21%)
ATP-synt_B <1180..1231 CDD:304375 13/51 (25%)
LCD1 1485..>1594 CDD:286837 19/141 (13%)
soga1XP_005162024.2 APG6 249..>348 CDD:309295 38/131 (29%)
SMC_N 318..1176 CDD:330553 227/1069 (21%)
SOGA 447..541 CDD:314335 34/195 (17%)
SOGA 574..678 CDD:314335 25/128 (20%)
DUF4482 1189..>1230 CDD:317254 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4787
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000945
OrthoInspector 1 1.000 T596139
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.