DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18304 and Mtcl1

Sequence 1:NP_001260170.1 Gene:CG18304 FlyBaseID:FBgn0031869 Length:1901 Species:Drosophila melanogaster
Sequence 2:XP_006524912.1 Gene:Mtcl1 MGIID:1915867 Length:2022 Species:Mus musculus

Alignment Length:2083 Identity:421/2084 (20%)
Similarity:710/2084 (34%) Gaps:692/2084 (33%)


  Fly   116 PATA--STSRAASSAEDQDVAVTVKLPVPPRRHTTALDIKEVEHAITPPTRVTSSPSKTSSIPDE 178
            ||||  |..||.:.|..:..::..|.|..|                .||    ::|.:.|     
Mouse    56 PATATPSAGRAPTPAAPRSPSLAGKAPPSP----------------GPP----AAPGRLS----- 95

  Fly   179 LVILSTDSLAERVRKMNLL-----KKQRSLNSRENSRERSVP--RR------EEESESTATPTPV 230
                         |:..::     |......:|.....::||  ||      .|.......||..
Mouse    96 -------------RRSGVVPGAKDKPPPGAGARSAGGAKAVPGTRRAARAGPAEPLSRVGRPTGA 147

  Fly   231 VPDRPERSKSGTSLNQLAQAEQKRAALPPKKVAVASTTTAS---------SSNSSSTSLKTSNST 286
            .|  |.....|....:.......||.:||.:.:.....|.|         :...||:.|....|.
Mouse   148 EP--PPAVAKGRKTKRGPGTPPARAVVPPARASRVPAVTLSVTSVAGCRINHTDSSSDLSDCASE 210

  Fly   287 SASNEVKVVTSTSS---SSTSSSS---VRRKEADSVASK---------EIKRQTVPAASIS-HSN 335
            ..|:|.:::.:.||   |.|.||.   :|.....|..|:         .|.....|.||.. ...
Mouse   211 PLSDEQRLLPAASSDAESGTGSSDREPIRGAPTPSSGSRGPPPGSPEPPILLAAPPVASACLGGR 275

  Fly   336 STSSTASTASKSQDTNGMQEQMKALKLELETMKTRAEKAEREKSDILLRRLASMDTASNRTAASE 400
            |:...|||.|...   |.||.:             ..:|..|::.:             .|:...
Mouse   276 SSPGGASTGSPGP---GSQEDV-------------GGRAPPERTIL-------------GTSKEP 311

  Fly   401 ALNLQQKLNEMKEQLDRVTEDKRKLNLRMKELENKGSESELRRKLQAAEQICEELMEENQSAKKE 465
            :|..|.:|..:.|                        |.||.|::       |||..||...|.|
Mouse   312 SLGEQPRLLVVAE------------------------EEELLREM-------EELRSENDYLKDE 345

  Fly   466 ILNLQAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSDRKIETLEQERQSSFNAE 530
            :..|:|||:|::|::.:::......|:::|::|.||||||.::|:|:::|  :|:.......:.|
Mouse   346 LDELRAEMEEMRDSYLEEDGYQLQELRRELDRANKNCRILQYRLRKAEQK--SLKVAETGQVDGE 408

  Fly   531 LSNKIKKLEEELRFSNELTRKLQAEAEELRNPGKKKAPMLGVLGKSTSADAKFTRESLTRGGSQE 595
            |   |:.||::|:.:.:::.:|..|.|.:..                           .|..:::
Mouse   409 L---IRSLEQDLKVAKDVSVRLHHELETVEE---------------------------KRAKAED 443

  Fly   596 DPQHLQRELQDSIERETDLKDQLKFAEEELQRLRDRERKRVRFSCGTQTEVPLEVVAFPRGTQTV 660
            |.:.|::::   ||.|.    ..:..:.|::|||:...||                   ||:   
Mouse   444 DNETLRQQM---IEVEV----SRQALQNEVERLRESSLKR-------------------RGS--- 479

  Fly   661 ATVQSDMSTSVENLVTSNVAVTQTDFEVPDRNVSIERETMSSPFAGLFPPSSSSRVGQSGSLLFP 725
                                          |.:..|::.                |.|:|.:..|
Mouse   480 ------------------------------REMYKEKKL----------------VNQNGGVERP 498

  Fly   726 SAISHVLLSGAGRKLSPTPHPHRLAPEVHADRDEGI-SDEDDPAELRILLELNEQEASILRLKVE 789
                       |...|.|....:|||.........| :.:||.|:|:..|:..::|||::|.|:.
Mouse   499 -----------GNCRSATKTQRKLAPRRKITLPRAILAWQDDSADLKCQLQFVKEEASLMRKKMA 552

  Fly   790 DLEKENAESKKYVRELQAKLRQDSSNGSKSSLLSLGTSSSAAEKKVKTLNEELVQLRRTLTEKEQ 854
            .|.:|..|.:   :|||   :..|..|...|.|..|.:......:     |..::||..|.|:|.
Mouse   553 KLGREKDELE---QELQ---KYKSLYGDVDSPLPTGEAGGPPSTR-----EAELKLRLKLVEEEA 606

  Fly   855 TVDSLKNQLSKLDTLETENDKLAKENKRLLALRKASEKTG--EVDQKMKESLAQAQRERDELTAR 917
            ::..     .|:..||.||..|..|.:. :.::...|.||  .|..........:.....||...
Mouse   607 SILG-----RKIVELEVENRGLKAEMED-IRVQHEREGTGRDHVPSTPTSPFGDSMESSTELRRH 665

  Fly   918 LKRMQLEAEDKLPPRTAKRVNDLTPKSHLKKWVEELEDEISEMRVMLS--------SSG--TDQL 972
            |:.::.|||                  .|::.:.|:||...::...||        .||  .|.:
Mouse   666 LQFVEEEAE------------------LLRRSISEIEDHNRQLTHELSKFKFEPHQESGWLGDGV 712

  Fly   973 KALQSAKGALEEDLRKCKQKLSLAEGDVQRLKLLNGSSSKVSELEQKLKRGDEEA----KKLNSK 1033
            ....:|...|:|:|:..:.::....|.|.:|:..|      ..|....:|||..|    :..:.:
Mouse   713 SKGPAASVPLQEELKSARLQIDELSGKVLKLQCEN------RLLLSNAQRGDLAAHLGLRAPSPR 771

  Fly  1034 LKDLEDKVKKQEAQLKLGETSKST------WESQSKREKEKLSSLEKDMEKQAKEKEKLEAKISQ 1092
            ..|.|....|:|:..:.|...:..      .||.|:...||.|........:|.|....|....:
Mouse   772 DSDAESDAGKKESDGEEGRLPQPKREGPVGGESDSEDMFEKTSGFGSGKPSEASEPCPAELLRVR 836

  Fly  1093 LDAE-LLSAKKSAEKSKSSLEKEIKD-------------------LKTKASKSDSKQVQDLKKQV 1137
            .|.| |::.|..|::.:.::|:.|.|                   ::....:.:|.....|   :
Mouse   837 EDTECLVTIKLEAQRLERTVERLISDTDGFIHDSGLRGNGLASPGVQGGGGEGNSPSEPHL---L 898

  Fly  1138 EEVQASLSAEQKRYEDLNNHWEKLSE--ETILMRAQLTTEKQSLQAELNASKQKIAEMDTIRIER 1200
            |.:...:.|.:|   :|....|::|.  :.:...:.||.....|....:.|:.  :.:.|     
Mouse   899 ETINVRMKAFRK---ELQAFLEQMSRIVDGLSPLSHLTESSSFLSTVTSVSRD--SPIGT----- 953

  Fly  1201 TDMARKLSEAQKRIADLQAKALKTVNGNGAEYERTVLKNKLAEKEHEYERLRRENEMNIDLVFQL 1265
              :.::|.      .|||:|..:.:     |::    .|:....|.|..|||...|::      .
Mouse   954 --LGKELG------PDLQSKLREQL-----EWQ----LNQDRGDEREGLRLRATRELH------R 995

  Fly  1266 RKDNDD-----LNGKLSDYN--------------RIEQAQSSLNGHGARREAE--------IREL 1303
            |.|.|.     |.|: |.:|              .:|:.|..|. ..||...|        ||::
Mouse   996 RADGDSGSHHGLGGQ-SCFNLELRGSPVLPEQSVSVEELQGQLE-QAARLHQEETETYTNKIRKM 1058

  Fly  1304 KEQ----LQSTELQMKSEVA--TVRLRYEQQVKN-LSGELTSMQRQCERF-KKDRDAFKQMLEVA 1360
            :|.    |:..||:|.|...  |:..|.....|| |..||.|:::....| .|.|...|...:..
Mouse  1059 EEDHLYALRWKELEMHSLALQNTLHKRTWSDEKNLLQQELRSLKQNIFLFYVKLRWLLKHWRQGK 1123

  Fly  1361 QKKIG--DLK-----ANNTGRQSRG--SMHSSD-----DDDKSKIAYLEQQIGHLEDQLVE--SR 1409
            |.:.|  ||:     .|..|....|  .:|.:|     |.|:.....:.:...|...|:.|  ||
Mouse  1124 QMEEGGEDLEESEHPENVPGLAELGVQGVHQTDGIDQEDADQGCSLPMGEHAPHSLVQISEHGSR 1188

  Fly  1410 LESS--------------------------------------KIKTELVSERSANEIKISEMQSK 1436
            |:||                                      :::.:..|:::|.:::.:.::.:
Mouse  1189 LQSSDGGPLNKQVVENQQLFRALKALLEDFRSELREDEHARLRLQQQYASDKAAWDVEWAVLKCR 1253

  Fly  1437 LNEFEE--ERVIGSGSTKLPGMKTKLELSWQKEREDQQRLLQETSTLARDLRQTLFEVERERDKE 1499
            |.:.||  |:.:|...:...| |..|    :||||..|:||.::.:|..|||..:...|:..::|
Mouse  1254 LEQLEEKTEKSLGELDSSAEG-KGAL----KKEREVHQKLLADSHSLVMDLRWQIHHREKNWNRE 1313

  Fly  1500 RLESKRKLDQIKRATEEEMEEGRKKIAELQCDLLELRDVHAKLRTSNEKLRRERERYEKELIKRR 1564
            ::|...:||      .|..|.||:|                      |:|....|:.:||...||
Mouse  1314 KVELLERLD------SERQEWGRQK----------------------EELLWRVEQLQKEKSPRR 1350

  Fly  1565 MEADGGDRKVGALLQTVDELVKIAPDLKIVGSGGSARSSSSSGYDKNLRPEQPNVRRSRSPS--P 1627
            .         |:.|                   .|.|...:..|     |.|.::..||..|  |
Mouse  1351 S---------GSFL-------------------CSRREDDTRPY-----PHQGSLHSSRPVSMWP 1382

  Fly  1628 TLSSSQI---TSVLARLAE-----ASEELRKFQRVNEDE-----------QERSRMRRSNLRRAA 1673
            ...:..|   ...|::|.|     |||.|.......:|:           .|....|:.||:||.
Mouse  1383 CEDADSIPFEDRPLSKLKESDRCSASENLYLDALSLDDDPGDPPPLRNCLAEEEESRKGNLQRAV 1447

  Fly  1674 S----------QENDPHGSTSSVASAAGSQRGGGRLSRNS--------SNNGSLIRKSLSLDHSI 1720
            |          .:..|......:.||...:.....||.:.        ||:..........|   
Mouse  1448 SVSCMSEFQRLMDVSPFLPEKGLPSAGSKEDVTPPLSPDDLKYIEEFHSNDWDYASPRAEAD--- 1509

  Fly  1721 QRDQNIW--RQDDGSV------------------------SSMQS------------IDSELGG- 1746
             |..:.|  |.:.|.|                        .:|.|            :.:|..| 
Mouse  1510 -RPPDPWADRTEMGRVGHEATTEPCPDPSWYLTTSVTMTTDTMTSPEHCQKQPLRTHVLTEQSGV 1573

  Fly  1747 -LVRDSSLDSRLDSRLSGGSTQSDI-PRG------------------------------PRKKKK 1779
             ::.......|:||..|||..:|.. |.|                              ||..:.
Mouse  1574 HVLHSPPAIRRVDSIASGGEGRSRADPEGPFPMSRARGNLADAKGGHPEPVLNRWPCTPPRHPRD 1638

  Fly  1780 GIMGKLRSLTK--------SSRNSESEISIQGSDSDISVASDMRSS---------KKDLRGRLSG 1827
            .:.|.||.|.:        :|..:..::|...||....||..:|::         .:|:..:.:|
Mouse  1639 CVEGSLRPLDRPICPSLGFASPLNSLDMSKNMSDDMKEVAFSVRNAICAGPAEPHVRDMACQTNG 1703

  Fly  1828 MFKRSGSASRSESMERAGSDQRPVAVTVVGHPDGPQPREPPPANSLTPRPIRSIPKPPSAGAPTT 1892
                          .|....|....::|     |.| .|...|:.:|..|.:.:  .|.||..||
Mouse  1704 --------------SRTAGTQTIQTISV-----GLQ-TEALRASGVTSSPHKCL--TPKAGGGTT 1746

  Fly  1893 PTT 1895
            |.:
Mouse  1747 PVS 1749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18304NP_001260170.1 Smc 404..1202 CDD:224117 170/843 (20%)
CENP-F_N 1012..1286 CDD:287456 61/325 (19%)
ATP-synt_B <1180..1231 CDD:304375 7/51 (14%)
LCD1 1485..>1594 CDD:286837 21/109 (19%)
Mtcl1XP_006524912.1 DUF2561 <123..>182 CDD:287749 14/61 (23%)
PspA 340..570 CDD:224755 73/354 (21%)
DUF3166 529..623 CDD:288256 31/110 (28%)
DUF3166 658..750 CDD:288256 23/116 (20%)
DUF4482 1297..1418 CDD:291484 39/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4787
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000945
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.960

Return to query results.
Submit another query.