| Sequence 1: | NP_001260170.1 | Gene: | CG18304 / 33969 | FlyBaseID: | FBgn0031869 | Length: | 1901 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005162464.1 | Gene: | soga3b / 336052 | ZFINID: | ZDB-GENE-081022-198 | Length: | 807 | Species: | Danio rerio |
| Alignment Length: | 944 | Identity: | 185/944 - (19%) |
|---|---|---|---|
| Similarity: | 342/944 - (36%) | Gaps: | 325/944 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 300 SSSTSSSSVRRKEADSVASKEIKRQTVPAASISHSNSTSSTAS-TASKSQDTNGMQEQMKALKLE 363
Fly 364 LETMKTRAEKAEREKSDILLRRLASMDTASNRTAASEALNLQQKLNEMKEQLDRVTEDKRKLNLR 428
Fly 429 M-----------------------------------------------------KELENKG---- 436
Fly 437 -------------SESELRRKLQAAEQICEELMEENQSAKKEILNLQAEMDEVQDTFRDDEVKAK 488
Fly 489 TSLQKDLEKATKNCRILSFKLKKSDRKIETLEQERQSSFNAELSNKIKKLEEELRFSNELTRKLQ 553
Fly 554 AEAEELRNPGKK----------KAPMLGVLGKSTSADAKFTRESLTRGGSQEDPQHLQRELQDSI 608
Fly 609 ERET-DLKDQLKFAEEELQRLR------DRERKRVRFSCGTQTEVPLEVVAFPRGTQTVATVQSD 666
Fly 667 MSTSVENLVTSNVAVTQTDFEVPDRNVSIERETMSSPFAGLFPPSSSSRVGQSGSLLFPSAISHV 731
Fly 732 LLSGAGRKLSPTPHPHRLAPEVHADRDEGISDEDDPAELRILLELNEQEASILRLKVEDLEKENA 796
Fly 797 ESKKYVRELQAKL----RQDSSNGSKSSL-----LSLGTSSSAAEKKVKTLNEELVQLRRTLTEK 852
Fly 853 EQTVDSLKNQLSKLDTLE--------------------TENDKLAKENKRLLALRKASEKTGEVD 897
Fly 898 QKMKESLAQAQRERDELTARLKRMQLEAEDKLPPRTAKRVNDLTP-----------------KSH 945
Fly 946 LKK----WVEELEDEISEMRVMLSSSGTDQLKALQSAKGALEEDLRKCKQKLSLAEGDVQRL--- 1003
Fly 1004 --KLLNGSSSKVSELEQKLKRGDEEAKKLNSKLKDLED--KVKKQEAQLKLGETSKSTWESQSKR 1064
Fly 1065 EKEKLSSLEKDMEKQAKEKEKLEAKISQLDAELL 1098 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18304 | NP_001260170.1 | Smc | 404..1202 | CDD:224117 | 160/839 (19%) |
| CENP-F_N | 1012..1286 | CDD:287456 | 16/89 (18%) | ||
| ATP-synt_B | <1180..1231 | CDD:304375 | |||
| LCD1 | 1485..>1594 | CDD:286837 | |||
| soga3b | XP_005162464.1 | DUF3166 | 362..456 | CDD:288256 | 34/200 (17%) |
| DUF3166 | 488..584 | CDD:288256 | 21/105 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4787 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR15742 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.960 | |||||