DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18304 and soga3b

Sequence 1:NP_001260170.1 Gene:CG18304 FlyBaseID:FBgn0031869 Length:1901 Species:Drosophila melanogaster
Sequence 2:XP_005162464.1 Gene:soga3b ZFINID:ZDB-GENE-081022-198 Length:807 Species:Danio rerio

Alignment Length:944 Identity:185/945 (20%)
Similarity:342/945 (36%) Gaps:325/945 (34%)


  Fly   300 SSSTSSSSVRRKEADSVASKEIKRQTVPAASISHSNSTSSTAS-TASKSQDTNGMQEQMKALKLE 363
            ||:..:...||......::|       ||.:...|.|.||||| ..:||                
Zfish    15 SSADGTEGRRRPSPGQTSAK-------PALNPRGSRSASSTASKPGAKS---------------- 56

  Fly   364 LETMKTRAEKAEREKSDILLRRLASMDTASNRTAASEALNLQQKLNEMKEQLDRVTEDKRKLNLR 428
                 |:..:.|::...:.||..|::     |.|.:||      :.|.:|::||......:..||
Zfish    57 -----TKGREGEQDTRVVKLRGAAAV-----RGAETEA------ILETEERIDRAPPPDTRRALR 105

  Fly   429 M-----------------------------------------------------KELENKG---- 436
            .                                                     |.|...|    
Zfish   106 FPCVKRDSSAEKLDGAPGGVRGGQAAAGGEYVGCGPAFWGGGCLQSELIQYHINKRLRKSGRMQR 170

  Fly   437 -------------SESELRRKLQAAEQICEELMEENQSAKKEILNLQAEMDEVQDTFRDDEVKAK 488
                         :|..:.::.:|.::..|.|.:||...|..|..::.||:|::|||.:::....
Zfish   171 QTPGETQPGSGAQAEEVMTQQDEALQEEIERLEDENDELKSTIEEMRTEMEEMRDTFYEEDTCQL 235

  Fly   489 TSLQKDLEKATKNCRILSFKLKKSDRKIETLEQERQSSFNAELSNKIKKLEEELRFSNELTRKLQ 553
            ..::::||:|.||||||.::|:|::||  .|...:....:.:|   ::.||::|:.:.:::.:|.
Zfish   236 DEMRRELERANKNCRILQYRLRKAERK--RLRYAQTGEIDEDL---LRSLEQDLKVAKDVSVRLH 295

  Fly   554 AEAEELRNPGKK----------KAPMLGVLGKSTSADAKFTRESLTRGGSQEDPQHLQRELQDSI 608
            .|.|.:.....|          |...:.|..::...:....:||..|.|| :|.|..:|:.|...
Zfish   296 HELENVEEKRTKTEDENERLRQKLIEVEVTKQALQLELDKAKESQKRRGS-KDAQKPERKTQTPT 359

  Fly   609 ERET-DLKDQLKFAEEELQRLR------DRERKRVRFSCGTQTEVPLEVVAFPRGTQTVATVQSD 666
            |.:: |||.||.|.:||...:|      |:|:.|:.                 :..|...:...|
Zfish   360 EEDSEDLKCQLAFIKEEATLMRKKMAKIDKEKDRLE-----------------QELQKYRSFYGD 407

  Fly   667 MSTSVENLVTSNVAVTQTDFEVPDRNVSIERETMSSPFAGLFPPSSSSRVGQSGSLLFPSAISHV 731
            :.                                                               
Zfish   408 LD--------------------------------------------------------------- 409

  Fly   732 LLSGAGRKLSPTPHPHRLAPEVHADRDEGISDEDDPAELRILLELNEQEASILRLKVEDLEKENA 796
                       :|||...|......|:         :||::.|.|.|:||:||..|:.:||.|| 
Zfish   410 -----------SPHPKGEAGGPPTTRE---------SELKLRLRLVEEEANILGRKIVELEVEN- 453

  Fly   797 ESKKYVRELQAKL----RQDSSNGSKSSL-----LSLGTSSSAAEKKVKTLNEELVQLRRTLTEK 852
                  |.|:|:|    ..:||||..|..     ...|:..|...::::.:.:|...|||.|.:.
Zfish   454 ------RGLRAELDDLRGDESSNGGLSGAEGGIGREQGSELSELRQQLQLVEDEAELLRRNLADV 512

  Fly   853 EQTVDSLKNQLSKLDTLE--------------------TENDKLAKENKRLLALRKASEKTGEVD 897
            |:....:.::|:||...|                    ::::.|.:|.|  .|.::.:|.:|:| 
Zfish   513 EEQNKRVTSELNKLRFKEGTRHASGSNATGSNNGGGDSSKSEALQEELK--AARKQINELSGKV- 574

  Fly   898 QKMKESLAQAQRERDELTARLKRMQLEAEDKLPPRTAKRVNDLTP-----------------KSH 945
                   .|.|.|...|.:.::|..|.:...:.||.:...:|..|                 ..|
Zfish   575 -------MQLQYENRVLLSNMQRYDLASHLAVTPRDSDAESDGGPAIGGRRGSDDDSSSSRLPPH 632

  Fly   946 LKK----WVEELEDEISEMRVMLSSSGTDQLKALQSAKGALEEDLRKCKQKLSLAEGDVQRL--- 1003
            .|:    ..|...:|:...|.:   :.|..|.:.:||: .|...:|..:|.:.: ..:.:||   
Zfish   633 RKREGPVGGESDSEEVRNARCL---TPTRSLYSPESAR-LLSRSIRDRQQMIDI-RAEAERLGRT 692

  Fly  1004 --KLLNGSSSKVSELEQKLKRGDEEAKKLNSKLKDLED--KVKKQEAQLKLGETSKSTWESQSKR 1064
              :|:..:|:.::|....:..||     |..:::|.:|  ::::.|...::        .||.|.
Zfish   693 IDRLIADTSNIIAEARVFVANGD-----LFGRMEDEDDGGRIREHELLFRI--------NSQMKT 744

  Fly  1065 EKEKLSSLEKDMEKQAKEKEKLEAKISQLDAELL 1098
            .:::|......:|....|:...|..:|.....:|
Zfish   745 FRKELQGFIDRLEVPKPEERDSEEPLSMFQPIIL 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18304NP_001260170.1 Smc 404..1202 CDD:224117 160/840 (19%)
CENP-F_N 1012..1286 CDD:287456 16/90 (18%)
ATP-synt_B <1180..1231 CDD:304375
LCD1 1485..>1594 CDD:286837
soga3bXP_005162464.1 DUF3166 362..456 CDD:288256 34/201 (17%)
DUF3166 488..584 CDD:288256 21/106 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4787
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000945
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.