DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18304 and Soga1

Sequence 1:NP_001260170.1 Gene:CG18304 FlyBaseID:FBgn0031869 Length:1901 Species:Drosophila melanogaster
Sequence 2:NP_001158135.1 Gene:Soga1 MGIID:2444575 Length:1654 Species:Mus musculus

Alignment Length:1843 Identity:391/1844 (21%)
Similarity:671/1844 (36%) Gaps:566/1844 (31%)


  Fly   222 ESTAT---PTPVVPDRPERSKSGTSLNQLAQAEQKRAALP--PKKVAVASTTTASSSNSSSTSLK 281
            ||:|.   |.|......||.||            .||..|  ||.||..|...........::..
Mouse     7 ESSARGYGPPPAPAPAAERKKS------------HRAPSPARPKDVAGWSLAKGRRGTGPGSATA 59

  Fly   282 TSNSTSASNEVK---VVTSTSSSSTSSSSVRRKEADSVASKEIKRQTV----PAASISHSNSTSS 339
            ...::||..:.|   |...|..:....:.||    ..|.:|...|...    |....|.::|:|.
Mouse    60 CGTASSARPDKKGRAVAPGTRGTGPRVAGVR----TGVRAKGRPRPGTGPRPPPPPPSLTDSSSE 120

  Fly   340 TASTASKSQDTNGMQEQMKALKLELETMKTRAEKA--------------EREKSDILLRRLASMD 390
            .:..||         |:.:.|.||| .:.:.||.|              ..:......|..||.|
Mouse   121 VSDCAS---------EEARQLGLEL-ALSSDAESAAGGPAGTRTGQPPQPAQSGQQPPRPPASPD 175

  Fly   391 TASNRTAASEALNLQQKLNEMKEQLDRVTEDKRKLNLRMKELENKGSESELRRKLQAAEQICEEL 455
            ..|  .|||...:.:..|:......| :||:       |.:....|...||           |||
Mouse   176 EPS--VAASSVGSSRLPLSASLAFSD-LTEE-------MLDCGPGGLVREL-----------EEL 219

  Fly   456 MEENQSAKKEILNLQAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSDRKIETLE 520
            ..||...|.||..|:|||.|::|.:.:::|.....|::.|::|:|.||||.::|:|::|:  :|.
Mouse   220 RSENDYLKDEIEELRAEMLEMRDVYMEEDVYQLQELRQQLDQASKTCRILQYRLRKAERR--SLR 282

  Fly   521 QERQSSFNAELSNKIKKLEEELRFSNELTRKLQAEAEELRNPGKKKAPMLGVLGKSTSADAKFTR 585
            ..:....:.||   |:.||::::.|.:::.:|..|.|.:    :||...|               
Mouse   283 AAQTGQVDGEL---IRGLEQDVKVSKDISMRLHKELEVV----EKKRMRL--------------- 325

  Fly   586 ESLTRGGSQEDPQHLQRELQDSIERETDLKDQLKFAEEELQRLRDRE-RKRVRFSCGTQTEVPLE 649
                    :|:.:.|::.|     .||:|..|:  .:.||.|.|:.. :||...|.|...:.|  
Mouse   326 --------EEENEGLRQRL-----IETELAKQV--LQTELDRPREHSLKKRGTRSLGKTDKKP-- 373

  Fly   650 VVAFPRGTQTVATVQSDMSTSVENLVTSNVAVTQTDFEVPDRNVSIERETMSSPFAGLFPPSSSS 714
                     |.....:|:...:......:..:.:...::...|.|::.|.:.  :..|:      
Mouse   374 ---------TAQEDSADLKCQLHFAKEESALMCKKLTKLAKENDSMKEELLK--YRSLY------ 421

  Fly   715 RVGQSGSLLFPSAISHVLLSGAGRKLSPTPHPHRLAPEVHADRDEGISDEDDPAELRILLELNEQ 779
                 |.|  .:|:|       ..:|:..||...                   .||::.|:|.|:
Mouse   422 -----GDL--DAALS-------AEELADAPHSRE-------------------TELKVHLKLVEE 453

  Fly   780 EASILRLKVEDLEKENAESKKYVRELQAKLRQDSSNG------SKSSLLSLG--TSSSAAE--KK 834
            ||::|..::.:||.||       |.|:|::.....:|      ::.:..|||  ...|.||  :.
Mouse   454 EANLLSRRIVELEVEN-------RGLRAEMDDMKDHGGGGGPEARLAFSSLGGECGESLAELRRH 511

  Fly   835 VKTLNEELVQLRRTLTEKEQTVDSLKNQLSKLDTLETENDKLAKENKRLLALRKASEKTGEVDQK 899
            ::.:.||...|||:..|.|.....|.|:|:|..: |.|.|....|           :....:.:.
Mouse   512 LQFVEEEAELLRRSSAELEDQNKLLLNELAKYRS-EHELDVTLSE-----------DSCSVLSEP 564

  Fly   900 MKESLAQAQRERDELTARLKRMQLEAEDKLPPRTAKRVNDLTPKSHLKKWVEELEDEISEMRVML 964
            .:|.||.|:.:..||:.::|::|.                                   |.||:|
Mouse   565 SQEELAAAKLQIGELSGKVKKLQY-----------------------------------ENRVLL 594

  Fly   965 SSSGTDQLKALQSAKGALEEDLRKCKQKLSLAEGDVQRLKLLNGSSSKVSELEQKLKRGDEEAKK 1029
            |:.....|.:.||.:..||.|          ||.                        ||     
Mouse   595 SNLQRCDLASCQSTRPMLETD----------AEA------------------------GD----- 620

  Fly  1030 LNSKLKDLEDKVKKQEAQLKLGETSKSTWESQSK-REKEKLSSLEKDMEKQAKEKEKLEAKISQL 1093
                        ..|.....||||.:.......: ||.|.|..|        :|:..|.:|  .:
Mouse   621 ------------SAQCVPAPLGETLEPHAARLCRAREAEALPGL--------REQAALVSK--AI 663

  Fly  1094 DAELLSAKKSAEKSKSSLEKEIKDLKTKASKSDSKQVQDLKKQVEEVQASLSAEQKRYEDLNNHW 1158
            |..:..|...:...:..|:.|..||:...:..:|:..:|.|.    :.|                
Mouse   664 DVLVADANGFSVGLRLCLDNECADLRLHEAPDNSEGPRDAKL----IHA---------------- 708

  Fly  1159 EKLSEETILMRAQLTTEKQSLQAELNASKQKIAEMDTIRIERTDMA-----RKLSEAQKRIADL- 1217
                   ||:|..:      ||.||||..:|           .|:|     ::..|....:..| 
Mouse   709 -------ILVRLSV------LQQELNAFTRK-----------ADVALGSSGKEQPEPFPALPALG 749

  Fly  1218 ---QAKALKTVNGNGAEYERTVLKNKLAEKEHEYERLRRENEMNIDLVFQ----------LRKDN 1269
               .||.:......|::::....::.|     |:|...||.....||..:          ..:||
Mouse   750 SQGPAKEIMLSKDLGSDFQPPDFRDLL-----EWEPRIREAFRTGDLESKPDPSRNFRPYRAEDN 809

  Fly  1270 DDLNGKLSDYNRI-EQAQSSLNGHGARREAEIRELKEQLQSTELQMKSEVA------TVRLRYEQ 1327
            |....::.|...: .:|..||.|           |:||| |.|.|::.|.|      .|:|:.:|
Mouse   810 DSYASEIKDLQLVLAEAHDSLRG-----------LQEQL-SQERQLRKEEADSFNQKMVQLKEDQ 862

  Fly  1328 QVKNLSGEL----TSMQRQCER---------FKKDRDAFK-QMLEVAQKKIGDLKANNTGRQSRG 1378
            |...|..|.    .|:||:.|:         ..::...|| ..|.:..|....||     |..:|
Mouse   863 QRALLRREFELQSLSLQRRLEQKFWSQEKNILVQESQQFKHNFLLLFMKLRWFLK-----RWRQG 922

  Fly  1379 SMHSSDDDDKSKIAYLEQQIGHLEDQLVESRLESSKIKT-ELVSERSANE-IK-ISEMQSKLNE- 1439
            .:..|::||..::..:::....:|::.:.::...:|..| |..::.:.|| || :::|:..|.| 
Mouse   923 KVLPSEEDDFLEVNSMKELYLLMEEEEMNAQHSDNKACTGESWTQNTPNECIKTLADMKVTLKEL 987

  Fly  1440 ------------------------FEEERV------------IGSGSTKLPGMKTKLELSWQKER 1468
                                    :|.||.            .|.|:::.||...|..|  |:||
Mouse   988 CWLLQDERRGLTELQQQFAKAKATWETERAELKGHASQMELKAGKGASERPGPDWKAAL--QRER 1050

  Fly  1469 EDQQRLLQETSTLARDLRQTLFEVERERDKERLESKRKLDQIKRATEEEMEEGRKKIAELQ--CD 1531
            |:||.||.|:.:...:|.:.|...||...:|:|:...:|...|:..|::::|.:.::::||  .:
Mouse  1051 EEQQHLLAESYSAVMELTRQLQLSERHWSQEKLQLVERLQGEKQQVEQQVKELQNRLSQLQKAAE 1115

  Fly  1532 LLELRDVHAKLRTSNEKLRRERERYEKELIKRRMEAD-GGD----RKVGALLQTVDELVKIAPDL 1591
            ...|:....:.:.::.|..|..:.::||.:.   ||: ||.    .|..:.:...:.|:..:|.|
Mouse  1116 PWVLKHSDMEKQDNSWKEARSEKTHDKEGVS---EAELGGTGLKRTKSVSSMSEFESLLDCSPYL 1177

  Fly  1592 KIVGSGGSARSSSSSGYDKNLRPEQPNVRRSRSPSPTLSSSQITSVLARLAEASEELRKFQRVNE 1656
                :||.||       :|.|    ||       .|..:                    |.....
Mouse  1178 ----AGGDAR-------NKKL----PN-------GPAFA--------------------FVSTEP 1200

  Fly  1657 DEQERSRMRRSNLRRAASQENDPHGST---SSVASAAGSQRGGGRLSRN-SSNNGSLIRKSLSLD 1717
            .|.|:....::.|            ||   |.:.|.|..:..|.::.|: ::.:.:.||...|..
Mouse  1201 VEPEKDAKEKAGL------------STRDCSHIGSLACQEPAGRQMQRSYTAPDKTGIRVYYSPP 1253

  Fly  1718 HSIQRDQNIWRQDDGSV---------SSMQSIDSELGGLVRDSS---LDSRLDSRLSGGSTQSDI 1770
            .:.:....:....:|.:         ::.....:|..||...|.   |.:....||.|||..|..
Mouse  1254 VARRLGVPVVHDKEGKILIEPGFLFTTAKPKESAEADGLAESSYSRWLCNFSRQRLDGGSGASTS 1318

  Fly  1771 PRGPRKKKKGIMGKLRSLTKSSRNSESEISIQGSDSDISVASDMRSSKKDLRGRL-SGMFKRSGS 1834
            ..||                 :..:..:..:.|:.||     ||:.....:|..: ||..:|...
Mouse  1319 GSGP-----------------AFPALHDFEMSGNMSD-----DMKEITNCVRQAMRSGSLERKVK 1361

  Fly  1835 ASRSESMERAGSDQRPVAVTVVGHPDGPQPREPPPANSLTPR-----PIRS-------------I 1881
            .:.|:::..|....:.:....||....| ||....:.|.:||     .:||             |
Mouse  1362 NTSSQTVGVATVGTQTIRTVSVGLQTDP-PRSSLHSKSWSPRSSSLVSVRSKQISSSLDKVHSRI 1425

  Fly  1882 PKP---PSAGAPTTPTTRRRVAK 1901
            .:|   |..|:|  ...||.|:|
Mouse  1426 ERPCCSPKYGSP--KLQRRSVSK 1446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18304NP_001260170.1 Smc 404..1202 CDD:224117 169/810 (21%)
CENP-F_N 1012..1286 CDD:287456 54/295 (18%)
ATP-synt_B <1180..1231 CDD:304375 13/60 (22%)
LCD1 1485..>1594 CDD:286837 25/116 (22%)
Soga1NP_001158135.1 Tropomyosin 294..555 CDD:278679 75/355 (21%)
DUF3166 378..472 CDD:288256 25/142 (18%)
DUF3166 504..593 CDD:288256 29/136 (21%)
DUF4482 1065..1202 CDD:291484 35/182 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4787
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000945
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.960

Return to query results.
Submit another query.