DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18304 and lva

Sequence 1:NP_001260170.1 Gene:CG18304 FlyBaseID:FBgn0031869 Length:1901 Species:Drosophila melanogaster
Sequence 2:NP_001284849.1 Gene:lva FlyBaseID:FBgn0029688 Length:2779 Species:Drosophila melanogaster

Alignment Length:2050 Identity:413/2050 (20%)
Similarity:800/2050 (39%) Gaps:525/2050 (26%)


  Fly   119 ASTSRAASSAEDQDVAVTVKLPVPPRRHT----------TALDIKEVEHAITPPTRVTSSPSKTS 173
            |..|.|..|:.|..:       |.|..|.          ::.|:..:::.....||.|....:..
  Fly     2 AEDSGALESSYDFSI-------VQPDDHEYGEADIRLAGSSNDLSSLQNVSASTTRGTKGKGRLD 59

  Fly   174 SIPDELVILSTDSLAERVRKMNLLKKQRSLNSRENSRERSVPRREEESESTA------------- 225
            |:.:.|.     ...||:..:    |:|:|...::.|.:|......||..|.             
  Fly    60 SLKENLY-----KQQERLTAL----KERALRKSQDERHKSSMSDSMESLKTLGQKLTVLKTRSGD 115

  Fly   226 TPTPVVPDRPERSKSGTSLNQLA----------QAEQKRAALPPKKVAVASTTTASSSN------ 274
            :.||:|....:......||.|.:          :.||.||.|..:|..:|.:..:..||      
  Fly   116 SSTPLVSPTKDSDPGDVSLLQTSGSEKLLMLTQRTEQNRALLEQRKRDLAKSLLSVKSNIGHQTT 180

  Fly   275 ----SSSTSLKTSNSTS-------------------ASNEVKVVTSTSSSSTSSSSVRRKEADSV 316
                ||.|.|:.:.|.|                   |.:|.:|....|....:.....|:|.:  
  Fly   181 AELGSSMTDLRHAASVSNPPVSRHRSALDLEAQGQEAVDESRVKLLRSRMKLTELKQGRQEQE-- 243

  Fly   317 ASKEIKRQTVPAASISHSNSTSSTASTASKSQDTNGMQEQMKALKLELETMKTRAEKAEREKSDI 381
             ..|::.:....|.:......|......:.:| .|...||::.::.|.:::|.:.....:.:..:
  Fly   244 -LNELRTELAKRAKLIERLELSGAELQRTLTQ-RNEELEQLRVVQAEEDSLKVQENSRLQGEVLV 306

  Fly   382 LLRRLASMDTASNRTAASEALNLQQKLNEMKEQLDRVTEDKRKLNLRMKELENKGSESELRRKLQ 446
            |..|||.::..::.        |:....|::|:|  .|..:|:.||.:::.:.|.|.|.......
  Fly   307 LRERLAELENVNDL--------LETTRCELQEEL--TTARERQRNLELEQEQEKASRSPQSEAAH 361

  Fly   447 AAEQICEELMEENQSAKKEILNLQAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKK 511
            ...|:..||.::.|....::.:|||..:|::     .:|.|:..||...|       |:|.:|::
  Fly   362 TDAQVSAELAKQLQELTNQLADLQATNEELR-----QQVAAQAKLQVTDE-------IVSQRLEE 414

  Fly   512 SDRKI--ETLE-QERQSSF---NAELSNKIKKLEEELRFSNELTRKLQAEAEELRNPGKKKAPML 570
            .:..|  :.|| ||::|:.   |.||:.|..:|       |.|...|:...|:|....:.|...|
  Fly   415 LEATIAAQLLELQEQKSAMAAQNEELAEKTTEL-------NVLNVNLRLLEEKLAQSSRSKPLFL 472

  Fly   571 GVLGKSTSADAKFTRESLTRGGSQEDPQHLQRELQDSIERETDLKDQLKFAEEELQRLRDRERKR 635
                :..|.|:..:::      .|||.|.|:.:|.::.:....||.:.|.||::||:.:.::.::
  Fly   473 ----EDHSEDSAASKQ------MQEDLQQLKLKLDETNKANIKLKLKCKQAEKKLQKFQSQDGQQ 527

  Fly   636 VRFSC---GTQTEVPLEVVAFPRGTQTVATVQSDMSTSVENLVTSNVAVTQTDFEVPDRNVSIER 697
            ...|.   ..:.:..:.|:...:|...:|.:|.|.....::..::|....:|...:.::.:.:::
  Fly   528 QLASLLADNEELQQRIAVLEDEKGQWQLANMQEDDRQPEQSTESNNPLQLETIRLLEEQKLELQQ 592

  Fly   698 ETMSSPFAGLFPPSSSSRVGQSGSLLFPSAISHVLLSGAGRKLSP----------TPHPHRLAPE 752
                    .|....|||...:|..::   ...|:...|..|..|.          .|.|..::..
  Fly   593 --------ALEALLSSSSSAESIEIV---ERHHLECLGQRRPASEGDAQEQKQVHPPGPSHVSEL 646

  Fly   753 VHADRDEGISDEDDPAE----LRILLELNEQEASILRLKVEDLEKENAESKKYVRELQAKLRQDS 813
            ...::.|   :||...|    ||..|||..||...:..|:|.|..||.       :|||:|.:.|
  Fly   647 TQTEQTE---EEDSSGETLSQLRERLELFTQERGEVLDKLEQLSAENL-------QLQARLEESS 701

  Fly   814 SN-------GSKSSLLSLGTSSSAAEKKVKTLNEELVQLRRTLTEKEQTVDSLKNQLSKLDTLET 871
            |:       ..|..:.|..|||:        |::||..::|: :|...|:|:.:......:..| 
  Fly   702 SSLQLLQREREKDLISSTSTSSN--------LSQELSSMQRS-SEVVATLDAGEGGPVLFEKCE- 756

  Fly   872 ENDKLAKENKRLLALRKASEKTGE--VDQKMKESLAQAQRERDELTARLKRMQLEAEDKLPPRTA 934
              ..|:|.|..|.|.|||:::..:  |.:|:.:.......:..||..::|......|......|.
  Fly   757 --KSLSKLNSELEAYRKANDRQAKFNVSKKLAKEAKNCHTQLSELLHKVKEASTAVETVTVVETV 819

  Fly   935 KRVNDLTPK------------SHLKKWVEELEDEISEMR------------VMLSSSGTDQLKAL 975
            ..|.....|            :.||..:..|..|:.|:|            |...|...|::..|
  Fly   820 VAVTAPNGKALAEYEQLNAQNAELKAVISRLRQELDELRESYPETEAPLAIVGSDSQREDEILQL 884

  Fly   976 QS-----------AKGALEEDLRKCKQKLSLAEGDVQRLKLLNGSSSKVSELEQKLKRGDEEAKK 1029
            ||           .:..:||.:.:.|:   |.:.:.::|:|:...|:::::|:.:.::.|:   .
  Fly   885 QSQLEDARSLQAEQRQQIEEQVDQIKE---LRQTEAEQLQLVARQSAEITQLQLQSEQFDQ---L 943

  Fly  1030 LNSK--------------LKDLEDKVKKQEAQLKLGETSKSTWESQ---SKREKEKLSSLEKDME 1077
            ||||              .::||.:.:..|.:|.:.:|..:..:.|   |..|.|...:| |.:|
  Fly   944 LNSKEMSHEKQLEQQTRIRRELEARAESLEGELSILQTLVAEQKQQLIESVSESEHALNL-KMLE 1007

  Fly  1078 KQAKEKEKLEAKISQLDAELLSAKKSAEKSKSSLEKEIKDLKTKASKSDSKQVQDLKKQVEEVQA 1142
            .|:.::|..|.:..: |.:.|  :::...|||.:.:::::|     .|..:.|..|.:|::|.|.
  Fly  1008 LQSAQEELRELRAKE-DPDQL--REALRVSKSLVAQQVREL-----TSSQETVDALNQQIQEYQG 1064

  Fly  1143 SLSA---EQKRYEDLNNHWEKLSEETILMR------AQLTTEKQSLQAELNASKQKIAEMDTIRI 1198
            ...|   ||.:..:|.   |||.:..:.::      |.|..:.|.|.::|...::.:.:.:.:..
  Fly  1065 LEHAHKEEQFKNRELR---EKLKKYALNLKKRTQDNADLEQKVQELTSQLQEQQELVKQKEEVER 1126

  Fly  1199 ERTDMARKLSEAQKRIA----DLQAK---------ALKTVNGNGAEYERTVLKN-------KLAE 1243
            |......::.:.|::::    ||:||         ||:.:.....|.|:.:.:.       .|..
  Fly  1127 EPIVDNHRVEQLQQQVSKLNEDLKAKIHLNLENRDALRQLKQQIQEQEQLIQERDAELQDANLVS 1191

  Fly  1244 KEHEYERLRRENEMNIDLVFQLRKDNDDLNGKLS---------------DYNRIEQAQSSLNGHG 1293
            ||     ||||.:.....||||.::|..|..::|               :...:|..:..|....
  Fly  1192 KE-----LRRERQEADQEVFQLGQENSRLREEISKLQEEIHNLGQRVNEEPTAVEDLRRQLEAKS 1251

  Fly  1294 AR----------REAEIRELKEQLQSTELQMKSEVATV---RLRYEQQVKNLSGELTSMQRQCER 1345
            .:          |.|.|:.|:.:||..:....|||..|   |..:||.......|:|:::::..:
  Fly  1252 KKFEKSKELIKLRNATIQSLQRELQQLQQDQDSEVEHVRNARAAHEQLRLEKDAEITALRQEILK 1316

  Fly  1346 FKKDRDAFK---------------------QMLEVAQKKIGDLKANNTGRQSRGSM----HSSDD 1385
            .::.|.|.:                     :.|:||::::..|:...|..|.:.::    ::||.
  Fly  1317 LERSRAAGEGDDTITKTSHQLLESQSQQQAESLQVAERELQQLRVQLTAAQEQHALLAQQYASDK 1381

  Fly  1386 DD-KSKIAYLE--------------QQIGHLEDQLVESRLESSKIKTELVS---ERSANEIKISE 1432
            .: :..||.||              ..|..||.|..|.:..|:.::.:..|   :::|::.|:..
  Fly  1382 ANFEMTIARLETLHEGIQAKLQEDASYIESLEAQNTELQARSAALEEQAASQANQQAASQDKVQI 1446

  Fly  1433 MQSKLNEFEEERVIGSGSTKLPGMKTKLELSWQKEREDQQRLLQETSTLARDLRQTLFEV-ERER 1496
            ::.:|.|..|:..                   ||.::|||            |::..:|: :||:
  Fly  1447 LEQQLKEQREQEE-------------------QKRQQDQQ------------LQERFYELGQREQ 1480

  Fly  1497 DKERLESKRKLDQIKRATEEEMEEGRKKIAELQCDLLELRDVHAKLRTSNEKLRRER--ERYEKE 1559
            .:.|        |::..| .|.||.|:::|.|:.:...|...|::| |:..:..||:  ...::|
  Fly  1481 AQSR--------QLELLT-SEAEESRQQLAGLRTEYESLLAKHSQL-TATAQAEREQMSSHSQEE 1535

  Fly  1560 LIKRRMEADGGDRKVGALLQTVDELVKIAPDLKIVGSGGSARSSSSSGYDKNLRPEQPNVRRSRS 1624
            |.:.|.:.|..:..:....|..|  .|:|           |:::.....:.:|   ..:|.|:.:
  Fly  1536 LAELRQQLDVKEADLHRQRQVYD--AKLA-----------AKATELDELECDL---NSHVERAAA 1584

  Fly  1625 PSPTLSSSQITSVLARLAEASEELRKFQRVNEDEQERSRMRRSNLRRAASQENDPHGSTSSVASA 1689
            .:..| ..|:......:|:.:|||   ||:||:.||..| .||.|.|..                
  Fly  1585 ETREL-CQQLERSQELVAQRTEEL---QRLNEEFQEVER-ERSTLSREV---------------- 1628

  Fly  1690 AGSQRGGGRLSRNSSNNGSLIRKSLSLDHSIQRDQNIWRQDDGSVSSMQSIDSELGGLVRDSSLD 1754
                              :|:|    |.|. ..:|::....:..:.:||. .:|:      .:|.
  Fly  1629 ------------------TLLR----LQHD-SAEQDVLELQELRMQAMQD-KTEM------DNLR 1663

  Fly  1755 SRLDSRLSGGSTQSDIPRGPRKKKKGIMGKLRSLTKSSRNSESEISIQGSDSDISVASDMRSSKK 1819
            :::|:..:..|          ::.:.:..::..|....:|.        :|..:.:.::    .|
  Fly  1664 TQIDALCANHS----------QELQALQQRIAELDTLGQNQ--------TDDQVYIETE----NK 1706

  Fly  1820 DLRGRLSGMFKRSGSASRSESMERAGSDQRPVAVTVVGHPDGPQPREPPPANSL-------TPRP 1877
            .|..:||.:   ....:|.:..::.....         ||.....:.||||:..       .|.|
  Fly  1707 RLAEQLSEL---QAQLARQQHQQQQQQHH---------HPAVQSQQHPPPASLFFGGDALAAPSP 1759

  Fly  1878 IRSIPK------------PPSAGAPTTPTTRRRVA 1900
            ...|.:            ||.:..||....:|.|:
  Fly  1760 FDEIAQPLRVSSLAASAPPPISPPPTIEDLQRNVS 1794

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18304NP_001260170.1 Smc 404..1202 CDD:224117 196/891 (22%)
CENP-F_N 1012..1286 CDD:287456 70/335 (21%)
ATP-synt_B <1180..1231 CDD:304375 9/64 (14%)
LCD1 1485..>1594 CDD:286837 27/112 (24%)
lvaNP_001284849.1 SMC_prok_B 327..1151 CDD:274008 198/906 (22%)
SMC_prok_B 952..1721 CDD:274008 177/919 (19%)
SMC_prok_B 1475..>2183 CDD:274008 80/431 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43939
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.