DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18304 and SOGA1

Sequence 1:NP_001260170.1 Gene:CG18304 FlyBaseID:FBgn0031869 Length:1901 Species:Drosophila melanogaster
Sequence 2:NP_542194.2 Gene:SOGA1 HGNCID:16111 Length:1661 Species:Homo sapiens

Alignment Length:1851 Identity:382/1852 (21%)
Similarity:670/1852 (36%) Gaps:592/1852 (32%)


  Fly   227 PTPVVPDRPERSKSGTSLNQLAQAEQKRAALP--PKKVAVASTTTASSSNSSSTSLKTSNSTSAS 289
            |.|.....|||.||            .||..|  ||.||..|...........:::..|.:.|:.
Human    17 PAPAPAPAPERKKS------------HRAPSPARPKDVAGWSLAKGRRGPGPGSAVACSAAFSSR 69

  Fly   290 NEVK---VVTSTSSSSTSSSSVRRKEADSVASKEIKRQTV----PAASISHSNSTSSTASTASKS 347
            .:.|   |......:....:.||    ..|.:|...|...    |....|.::|:|..:..||  
Human    70 PDKKGRAVAPGARGAGVRVAGVR----TGVRAKGRPRSGAGPRPPPPPPSLTDSSSEVSDCAS-- 128

  Fly   348 QDTNGMQEQMKALKLELETMKTRAEKAEREKSDILLRR----------------------LASMD 390
                   |:.:.|.||| .:.:.||.|....:.:...:                      :|:..
Human   129 -------EEARLLGLEL-ALSSDAESAAGGPAGVRTGQPAQPAPSAQQPPRPPASPDEPSVAASS 185

  Fly   391 TASNRTAASEALNLQQKLNEMKEQLDRVTEDKRKLNLRMKELENKGSESELRRKLQAAEQICEEL 455
            ..|:|...|.:|.......||   ||                   ...|.|.|:|       |||
Human   186 VGSSRLPLSASLAFSDLTEEM---LD-------------------CGPSGLVREL-------EEL 221

  Fly   456 MEENQSAKKEILNLQAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSDRKIETLE 520
            ..||...|.||..|:|||.|::|.:.:::|.....|::.|::|:|.||||.::|:|::|:  :|.
Human   222 RSENDYLKDEIEELRAEMLEMRDVYMEEDVYQLQELRQQLDQASKTCRILQYRLRKAERR--SLR 284

  Fly   521 QERQSSFNAELSNKIKKLEEELRFSNELTRKLQAEAEELRNPGKKKAPMLGVLGKSTSADAKFTR 585
            ..:....:.||   |:.||::::.|.:::.:|..|.|.:.   ||:|.:                
Human   285 AAQTGQVDGEL---IRGLEQDVKVSKDISMRLHKELEVVE---KKRARL---------------- 327

  Fly   586 ESLTRGGSQEDPQHLQRELQDSIERETDLKDQLKFAEEELQRLRDRERKRVRFSCGTQTEVPLEV 650
                    :|:.:.|::.|     .||:|..|:  .:.||:|.|:...|:               
Human   328 --------EEENEELRQRL-----IETELAKQV--LQTELERPREHSLKK--------------- 362

  Fly   651 VAFPRGTQTVATVQSDMSTSVENLVTSNVAVTQTDF-------------EVPDRNVSIERETMSS 702
                |||:::.  ::|..|.|:.  .|.....|..|             ::...|.|::.|.:. 
Human   363 ----RGTRSLG--KADKKTLVQE--DSADLKCQLHFAKEESALMCKKLTKLAKENDSMKEELLK- 418

  Fly   703 PFAGLFPPSSSSRVGQSGSLLFPSAISHVLLSGAGRKLSPTPHPHRLAPEVHADRDEGISDEDDP 767
             :..|:           |.|  .||:|       ..:|:..||...                   
Human   419 -YRSLY-----------GDL--DSALS-------AEELADAPHSRE------------------- 443

  Fly   768 AELRILLELNEQEASILRLKVEDLEKENAESKKYVRELQAKLRQDSSNG-------SKSSLLSLG 825
            .||::.|:|.|:||::|..::.:||.||       |.|:|::.....:|       ::.:..:||
Human   444 TELKVHLKLVEEEANLLSRRIVELEVEN-------RGLRAEMDDMKDHGGGCGGPEARLAFSALG 501

  Fly   826 ---TSSSAAE--KKVKTLNEELVQLRRTLTEKEQTVDSLKNQLSKLDTLETENDKLAKENKRLLA 885
               ...|.||  :.::.:.||...|||:..|.|.....|.|:|:|..: |.|.|....|      
Human   502 GGECGESLAELRRHLQFVEEEAELLRRSSAELEDQNKLLLNELAKFRS-EHELDVALSE------ 559

  Fly   886 LRKASEKTGEVDQKMKESLAQAQRERDELTARLKRMQLEAEDKLPPRTAKRVNDLTPKSHLKKWV 950
                 :....:.:..:|.||.|:.:..||:.::|::|.                           
Human   560 -----DSCSVLSEPSQEELAAAKLQIGELSGKVKKLQY--------------------------- 592

  Fly   951 EELEDEISEMRVMLSSSGTDQLKALQSAKGALEED----------------------LRKCKQKL 993
                    |.||:||:.....|.:.||.:..||.|                      :|.|:.: 
Human   593 --------ENRVLLSNLQRCDLASCQSTRPMLETDAEAGDSAQCVPAPLGETHESHAVRLCRAR- 648

  Fly   994 SLAEGDVQRLKLLNGSSSKVSELEQKLKRGDEEAKKLNSKLKDLEDKVKKQEAQLKLGETSKSTW 1058
               |.:|  |..|...::.||      |..|......|.....|...:..:.|..:|.|...:  
Human   649 ---EAEV--LPGLREQAALVS------KAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDN-- 700

  Fly  1059 ESQSKREKEKLSSLEKDMEKQAKEKEKLEAKISQLDAELLSAKKSAEKSKSS--------LEKEI 1115
             |:..|:.:.:.::   :.:.:..:::|.|...:.||.|..:.|..::|.||        |.|||
Human   701 -SEGPRDTKLIHAI---LVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLPPLGSQGLSKEI 761

  Fly  1116 ---KDLKTKASKSDSKQVQDLKKQVEEVQASLSAEQKRYEDLNNHWEKLSEETILMRAQLTTEKQ 1177
               |||.:.....|.:.:.:.:.::.|.        .|..||::            :...:...:
Human   762 LLAKDLGSDFQPPDFRDLPEWEPRIREA--------FRTGDLDS------------KPDPSRSFR 806

  Fly  1178 SLQAELNAS-KQKIAEMDTIRIERTDMARKLSEAQKRIADLQAKALKTVNGNGAEYERTVLKNKL 1241
            ..:||.|.| ..:|.|:..:          |:||...:..||                       
Human   807 PYRAEDNDSYASEIKELQLV----------LAEAHDSLRGLQ----------------------- 838

  Fly  1242 AEKEHEYERLRRENEMNIDLVFQLRKDN-DDLNGKLSDYNRIEQAQSSLNGHGARREAEIRELKE 1305
                   |:|.:|.        ||||:. |:.|.|:....  |..|.:|    .|||.|      
Human   839 -------EQLSQER--------QLRKEEADNFNQKMVQLK--EDQQRAL----LRREFE------ 876

  Fly  1306 QLQSTELQMKSEVATVRLRYEQQVKNLSGELTSMQRQCERFKKDRDAFKQMLEVAQKKIGDLKAN 1370
             |||..||.:.|     .::..|.||:      :.::.::||.:      .|.:..|....||  
Human   877 -LQSLSLQRRLE-----QKFWSQEKNM------LVQESQQFKHN------FLLLFMKLRWFLK-- 921

  Fly  1371 NTGRQSRGSMHSSDDDDKSKIAYLEQQIGHLEDQLVESRLESSKIKT-ELVSERSANE-IK-ISE 1432
               |..:|.:..|:.||..::..:::....:|::.:.::...:|..| :..::.:.|| || :::
Human   922 ---RWRQGKVLPSEGDDFLEVNSMKELYLLMEEEEINAQHSDNKACTGDSWTQNTPNEYIKTLAD 983

  Fly  1433 MQSKLNE----FEEERVIGSGSTKLPGMKTKLELSW----------------------------- 1464
            |:..|.|    ..:||   .|.|:|.....|.:.:|                             
Human   984 MKVTLKELCWLLRDER---RGLTELQQQFAKAKATWETERAELKGHTSQMELKTGKGAGERAGPD 1045

  Fly  1465 -----QKEREDQQRLLQETSTLARDLRQTLFEVERERDKERLESKRKLDQIKRATEEEMEEGRKK 1524
                 |:|||:||.||.|:.:...:|.:.|...||...:|:|:...:|...|:..|::::|.:.:
Human  1046 WKAALQREREEQQHLLAESYSAVMELTRQLQISERNWSQEKLQLVERLQGEKQQVEQQVKELQNR 1110

  Fly  1525 IAELQ--CDLLELRDVHAKLRTSNEKLRRERERYEKELIKRRMEADGGDRKVGALLQTVDE---L 1584
            :::||  .|...|:....:.:.::.|..|..:.::||.:. .:|..|...|....:.::.|   |
Human  1111 LSQLQKAADPWVLKHSELEKQDNSWKETRSEKIHDKEAVS-EVELGGNGLKRTKSVSSMSEFESL 1174

  Fly  1585 VKIAPDLKIVGSGGSAR-----SSSSSGYDKNLRPEQPNVRRSRSPSPTLSSSQITSVLARLAEA 1644
            :..:|.|    :||.||     ::.:.|:..: .|..|  .:.....|.|||...          
Human  1175 LDCSPYL----AGGDARGKKLPNNPAFGFVSS-EPGDP--EKDTKEKPGLSSRDC---------- 1222

  Fly  1645 SEELRKFQRVNEDEQERSRMRRSNLRRAASQENDPHGSTSSVASAAGSQRGGGRLSRNSSNNGSL 1709
                                  ::|...|.|  ||.|.....:..|..:.|              
Human  1223 ----------------------NHLGALACQ--DPPGRQMQRSYTAPDKTG-------------- 1249

  Fly  1710 IRKSLSLDHSIQRDQNIWRQDDGSV---------SSMQSIDSELGGLVRDSS---LDSRLDSRLS 1762
            ||...|...:.:....:....:|.:         ::.....:|..||...|.   |.:....||.
Human  1250 IRVYYSPPVARRLGVPVVHDKEGKIIIEPGFLFTTAKPKESAEADGLAESSYGRWLCNFSRQRLD 1314

  Fly  1763 GGSTQSDIPRGPRKKKKGIMGKLRSLTKSSRNSESEISIQGSDSDISVASDMRSSKKDLRGRL-S 1826
            |||..|....||     |....|.           :..:.|:.||     ||:.....:|..: |
Human  1315 GGSAGSPSAAGP-----GFPAALH-----------DFEMSGNMSD-----DMKEITNCVRQAMRS 1358

  Fly  1827 GMFKRSGSASRSESMERAGSDQRPVAVTVVGHPDGPQPREPPPANSLTPR-----PIRS------ 1880
            |..:|...::.|:::..|....:.:....||....| ||......:.:||     .:||      
Human  1359 GSLERKVKSTSSQTVGLASVGTQTIRTVSVGLQTDP-PRSSLHGKAWSPRSSSLVSVRSKQISSS 1422

  Fly  1881 -------IPKP---PSAGAPTTPTTRRRVAK 1901
                   |.:|   |..|:|  ...||.|:|
Human  1423 LDKVHSRIERPCCSPKYGSP--KLQRRSVSK 1451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18304NP_001260170.1 Smc 404..1202 CDD:224117 179/857 (21%)
CENP-F_N 1012..1286 CDD:287456 54/287 (19%)
ATP-synt_B <1180..1231 CDD:304375 11/52 (21%)
LCD1 1485..>1594 CDD:286837 25/114 (22%)
SOGA1NP_542194.2 DUF3166 380..474 CDD:288256 28/142 (20%)
DUF3166 508..597 CDD:288256 29/136 (21%)
DUF4482 1069..1206 CDD:291484 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4787
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000945
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.