DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18304 and soga1

Sequence 1:NP_001260170.1 Gene:CG18304 FlyBaseID:FBgn0031869 Length:1901 Species:Drosophila melanogaster
Sequence 2:XP_002942331.2 Gene:soga1 XenbaseID:XB-GENE-6049995 Length:1617 Species:Xenopus tropicalis

Alignment Length:2031 Identity:373/2032 (18%)
Similarity:655/2032 (32%) Gaps:784/2032 (39%)


  Fly   215 PRREEESESTATPTPVVPDRPERSKSGTSLNQLAQAE-QKRAALPPKKVAVASTTTASSSNSSST 278
            |...|:.:....|:|..|    :..||.||::..::. ...:.|||          .......|.
 Frog    13 PPAPEKKKMNRAPSPARP----KELSGWSLSKTRRSSPASLSVLPP----------GPRRPLPSP 63

  Fly   279 SLKTSNSTSASNEVKVVTSTSSSSTSSSSVRRKEADSVASKEIKRQTVPAASISHSNSTSSTAST 343
            ..|.........:.|.:.......|.|||     ..|.||:|                :|.|:..
 Frog    64 GTKKQPGARPGGKSKSLGGAPGPRTDSSS-----EGSCASEE----------------SSGTSRG 107

  Fly   344 ASKSQDTNGMQEQMKALKLELETMKTRAEKAEREKSDILLRRLASMDTASNRTAASEALNLQQKL 408
            ||..:...|                                     ...|:|...|.::....  
 Frog   108 ASSEEGGGG-------------------------------------SGTSSRMQCSTSMAFSD-- 133

  Fly   409 NEMKEQLDRVTEDKRKLNLRMKELENKGSESELRRKLQAAEQICEELMEENQSAKKEILNLQAEM 473
                     :|||          |.:.|:|..||.        .:||..||...|.||..|::||
 Frog   134 ---------LTED----------LLDGGTEGLLRE--------MDELRSENDYLKDEIEELRSEM 171

  Fly   474 DEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSDRK--------------IETLEQE-- 522
            .|::|.:.:::|.....|::.||:..|.||||.::|||::|:              |.||||:  
 Frog   172 LEMRDVYMEEDVYQLQELRQQLEQVHKTCRILQYRLKKAERRGLRVAQTGQVDSELISTLEQDVK 236

  Fly   523 -------RQSSFNAELSNKIKKLE---EELR---FSNELTRK-LQAEAEELRNPGKKKAPMLGVL 573
                   |..|....:..|..|||   ||||   ...:|.:: ||.|.|:::....||....|.:
 Frog   237 VAKDVSVRLHSELEAVEKKRIKLEDENEELRQRLIETDLAKQVLQNEMEKMKENSLKKRRSSGRI 301

  Fly   574 GKSTSADAKFTRESLTRGGSQEDPQHLQRELQDSIERETDLKDQLKFAEEELQRLRDRERKRVRF 638
            .|..|.              |||              ..|||.||.||:||...:          
 Frog   302 DKKPSL--------------QED--------------SADLKCQLHFAKEESALM---------- 328

  Fly   639 SCGTQTEVPLEVVAFPRGTQTVATVQSDMSTSVENLVTSNVAVTQTDFEVPDRNVSIERETMSSP 703
             |...|::..:............::..||                      |.::|:|       
 Frog   329 -CKKLTKLAKDNDNMKEDLTKYRSMYGDM----------------------DSSLSVE------- 363

  Fly   704 FAGLFPPSSSSRVGQSGSLLFPSAISHVLLSGAGRKLSPTPHPHRLAPEVHADRDEGISDEDDPA 768
                                               :|:.:||...                   |
 Frog   364 -----------------------------------ELANSPHSRE-------------------A 374

  Fly   769 ELRILLELNEQEASILRLKVEDLEKENAESKKYVRELQAKLRQDSSNGSKSSLLSL-----GTSS 828
            ||::.|:|.|:||::|..::.:||.||...:..:.|:  |:..|....|:....:.     |.:.
 Frog   375 ELKVHLKLVEEEANLLSRRIVELEVENRGLRAEMDEM--KIHHDRELLSQDGRFAFPPGESGDNF 437

  Fly   829 SAAEKKVKTLNEELVQLRRTLTEKEQTVDSLKNQLSKLDTLETENDKLAKENKRLLALRKASEKT 893
            ....:.::.:.||...|||::.|.|.....|.|:|:|   .::::|         |.:..:.:..
 Frog   438 VELRRHLQFVEEEAELLRRSMMELEDQNKLLMNELNK---YKSDHD---------LDITLSEDSC 490

  Fly   894 GEVDQKMKESLAQAQRERDELTARLKRMQLEAEDKLPPRTAKRVNDLTPKSHLKKWVEELEDEIS 958
            ..:.:..:|.|..|:.:..||:.::|::|.                                   
 Frog   491 SVISEPSQEELTTAKMQISELSGKVKKLQY----------------------------------- 520

  Fly   959 EMRVMLSSSGTDQLKALQSAKGALEEDLR-----KCKQKLSLAEGDVQRLKLLNGSSSKVSELEQ 1018
            |.||:||:.....|.:.|:.:..:|.|..     :|.......||.:       |..:..::.::
 Frog   521 ENRVLLSNLQRYDLASCQATRPLMETDAEAGDSAQCVPSPLWREGPI-------GGETDAADSKE 578

  Fly  1019 KLKRGDEEAKKLN----SKLKDLEDKVKKQEAQLKLGETSKSTWESQSKREKEKLSSLEKDMEKQ 1079
            :..:|:..:..::    |||      :|.:|.:..||.|:::...|::                 
 Frog   579 QEGKGNTRSPNVSHSSPSKL------IKVKELETLLGITTQAGLISKA----------------- 620

  Fly  1080 AKEKEKLEAKISQLDAELLSAKKSAEKS--KSSLEKEIKDLKTKASKSDSKQVQDLKKQVEEVQA 1142
                           .|:|.:..:...|  |...:.:..||....:..:|:...| .|.:..:.:
 Frog   621 ---------------IEVLKSDYNGFPSGVKLRTDNDCGDLLLTEAIDNSEMTSD-SKLIGAIFS 669

  Fly  1143 SLSAEQKRYEDLNNHWEKLSEETILMRAQLTTEKQSLQAELNASKQKIAEMDTIRIERTDMARKL 1207
            .|:.                                ||.|||...:|:..:.....|:.|.:..|
 Frog   670 RLAV--------------------------------LQQELNCFTKKVDALGACCKEQMDSSASL 702

  Fly  1208 SEAQKRIADLQAKALKTVNGNGAEYERTVLKNKLAEKEH-------EYERLRRENE--------- 1256
            .||..                      |......:.|||       |...||::.|         
 Frog   703 PEAAS----------------------TDTSKDSSRKEHCSNVQQPECRNLRQKEEPCTEKQDGD 745

  Fly  1257 MNIDLVFQLR-------KDNDDLNGKLSDYNRI-EQAQSSLNG--HGARREAEIR---------- 1301
            .|.|   |.|       :|||....::.|...: .:|..|:.|  ....:|.|:|          
 Frog   746 HNCD---QTRSYKTYQPEDNDSYAAEIKDLQLVLSEANESIQGLQEQLSQERELRKEDKMAYNQK 807

  Fly  1302 --ELKEQLQSTELQMKSEVATVRLRYEQQVKNLSGELTSMQRQCERFKKD--------------- 1349
              :|||..:...|:.:.|:.::.|:...:.|..|.|...:.::..:||::               
 Frog   808 IAQLKEDQEKLLLRREFELQSLGLQRRLEQKFWSQEKNVLVQETHQFKQNFLLLFMKLKWYLQHW 872

  Fly  1350 -------RDAFKQMLEVAQKK--------------IGDLKAN-------NTGRQSRGSMHSSDDD 1386
                   ||.  ..|||...|              |.|.|.:       |..|:|          
 Frog   873 RQGKALPRDG--DFLEVNSVKELYMLIEEEELNPPISDYKVSDGESWPQNVARES---------- 925

  Fly  1387 DKSKIAYLEQQIGHLEDQLVESRLESSKIKTELVSERSANEIKISEMQSKLNEFEEERVIGSGST 1451
             ...|:.::..:..|.::|.|.|...::::.:....::|.|::  .|:.||:         ||..
 Frog   926 -MKTISDIKGTLKDLCNELQEERRGMNELQQQFAKAKAAWEME--RMEFKLD---------SGKH 978

  Fly  1452 KLPGMKTKLELSWQKEREDQQRLLQETSTLARDLRQTLFEVERERDKERLESKRKLDQIKRATEE 1516
            .:....:.|:.:.::|||:.|.||.|:.:...||.:.|...|:...:|:.|...:....::..::
 Frog   979 GVDRASSDLKSALKREREEHQHLLAESYSAVMDLTKQLQVNEKNWAQEKEELLNRFQDERKLADQ 1043

  Fly  1517 EMEEGRKKIAELQCDLLELRDVHAKLRTSNEKLRRERERYE---KELIKRRMEAD--------GG 1570
            :|.|.:||:.:.:.|               ..:::|.||..   ||.:..:::..        ..
 Frog  1044 QMRELQKKLKQKEAD---------------SWVKKEPERRSSCWKEAVSNKLQDKDIDCDCDCDS 1093

  Fly  1571 DRKVGALLQT--------VDELVKIAP-----------------------DLKIVGSGGSARSSS 1604
            |..|.:|.:|        .:.|:..:|                       .|.:.||..|.:..|
 Frog  1094 DASVTSLKRTKSVSSMSEFESLLDCSPFLHDNTSSANGENANERRGLPASTLLVNGSKNSEKHCS 1158

  Fly  1605 SSGYDKNL------------------------------------RPEQPNVRRSRSPS------- 1626
            ..|.|.:|                                    .|::..:|...||.       
 Frog  1159 YEGNDNSLAGHLPKGNLVISSWDYTMAKADNRVDGQKHIQRSYTAPDKTGIRIYYSPPVVRRLDV 1223

  Fly  1627 PTLSSSQ-----ITSVLARLAEASE-----------------ELRKFQR---------------- 1653
            |.:.:.:     .|..|..:|:..|                 ...|.||                
 Frog  1224 PLVQNKEDKLMVETGFLFTMAKPKESEKSDGLSGNSYSRWLCNFSKKQRDLLDGDSVKDSSSVPG 1288

  Fly  1654 -------------VNEDEQE-----RSRMRRSNLRR----AASQ-------------------EN 1677
                         :::|.:|     |..:|.|:|.|    .|||                   :.
 Frog  1289 FPSSLGDLEISGNMSDDMKEITNCVRQAIRSSSLERKPKSTASQTVGLSSVGVQTVQMVSVGLQT 1353

  Fly  1678 DPHGSTSSVASAAGSQRGGGRLSRNSSNNGSLIRKSLSLDHS---------------IQR----- 1722
            ||  :.||:.|.:.|.|....||..:.:    |..||...||               :||     
 Frog  1354 DP--TRSSLTSKSWSPRSSSLLSTRTKH----ISTSLDKVHSRIDRPCCSPKYGSPKLQRRLSSK 1412

  Fly  1723 -----DQNIW----RQDDGS--VSSMQSIDSELGGLVRD--SSLDSRLDSRLSGGSTQSDIPRG- 1773
                 |:::|    .:.:||  ..|..:.||.:...:.|  |||.:.:|   ..|||:|....| 
 Frog  1413 LDGSKDRSLWNLHQNKQNGSAWARSTTTRDSPVLSNINDGSSSLFNVVD---HAGSTESICRLGL 1474

  Fly  1774 --PRKK----KKGIMGK-LRSLTKSSRNSESEISIQGSDSDISVASDMRS--------------- 1816
              .|.|    |.||:.: .|::...:..|.|.:|.:....|.:...|...               
 Frog  1475 GESRSKSDTPKYGIVQEFFRNVCGRTSQSSSAVSEKKEAEDCNKRPDNHDHCSSVCHSTYNVSKL 1539

  Fly  1817 -SKKDLRGRLSGMFKRSGSASRSESMERAGSD-------QRPVAVTVVGHPDGPQPREPPPANSL 1873
             |||..|...|.  ::.||...||.:..:.::       .:|: .:....|..||.|:......|
 Frog  1540 LSKKVPRQHTSD--EQKGSPKDSEVIATSTNEDYACNCSSQPL-TSCFSRPSRPQSRQAQYKCQL 1601

  Fly  1874 TPRPIRSIPKPPSAGA 1889
            .|.|  ::|:..:..|
 Frog  1602 HPDP--TVPEDKAGPA 1615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18304NP_001260170.1 Smc 404..1202 CDD:224117 158/844 (19%)
CENP-F_N 1012..1286 CDD:287456 48/304 (16%)
ATP-synt_B <1180..1231 CDD:304375 10/51 (20%)
LCD1 1485..>1594 CDD:286837 22/151 (15%)
soga1XP_002942331.2 DUF3166 310..404 CDD:288256 33/202 (16%)
DUF3166 439..525 CDD:288256 23/133 (17%)
DUF4482 1010..>1120 CDD:291484 21/125 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4787
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000945
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.