DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18304 and soga3

Sequence 1:NP_001260170.1 Gene:CG18304 FlyBaseID:FBgn0031869 Length:1901 Species:Drosophila melanogaster
Sequence 2:XP_005157901.1 Gene:soga3 ID: Length:805 Species:Danio rerio

Alignment Length:941 Identity:199/942 (21%)
Similarity:367/942 (39%) Gaps:252/942 (27%)


  Fly   243 SLNQLAQAEQKRAALPPKKVAVASTTTASSSNSSSTSL-KTSNSTSASNEV------------KV 294
            |:..:.|.:|::.|..|.:...:.|..||.|..|..|. ||...:|.||..            |.
Zfish     3 SVENMKQQQQQQRASSPGRFKDSPTKAASKSGCSKASASKTGGKSSRSNSPVTVHTGKDRHAGKG 67

  Fly   295 VTSTSSSSTSSSSVRRKEADSVASKEIKRQTVPAASISHSNSTSSTASTASKSQDTNGMQEQMKA 359
            ..:..:|...|.::||.|......:....:...||:..........:...|.|:.:.|.:|..||
Zfish    68 AAAVHASGAESPTLRRAEKGRSTERSGSSEEPYAAAEEPLLGADVVSDQPSSSKPSPGKRESSKA 132

  Fly   360 LKLELETMKTRAEKAE-------RE---KSDIL-------LRRLASMDTASNRTAASEALNLQQK 407
                 :..|..|:.|.       ||   :|:::       |::.:.|.|.:..:..:|.      
Zfish   133 -----DGGKQAAKSAVGCGPGFWREGCLQSELIQFHMNKSLKKDSGMTTKTPSSPVTEP------ 186

  Fly   408 LNEMKEQLDRVTEDKRKLNLRMKELENKGSESELRRKLQAAEQICEELMEENQSAKKEILNLQAE 472
                    .|..||.|:....:.|.:            |..|:..|.|.:||...|.||..::||
Zfish   187 --------QRPPEDTRRPAEPLPEPD------------QELEEEIERLQDENDFLKHEIDEMRAE 231

  Fly   473 MDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSDRKIETLEQERQSSFNAELSNKIKK 537
            |||::|||.:::......::::||:|.||||||.::|:|::||  .:........::||   ::.
Zfish   232 MDEMRDTFYEEDACQLQDMRRELERAHKNCRILQYRLRKAERK--RMRYAETGEIDSEL---LRS 291

  Fly   538 LEEELRFSNELTRKLQAEAEELRNPGKKKAPMLGVLGKSTSADAKFTRESLTRGGSQEDPQHLQR 602
            ||::|:.:.:::.:|.   .||.|...|:|        .|..:.:..|:.|.      :.:..::
Zfish   292 LEQDLKVAKDVSVRLH---NELENVEDKRA--------RTDDENERLRQQLI------EVEVTKQ 339

  Fly   603 ELQDSIERETDLKDQLKFAEEELQRLRDRERKRVRFSCGTQTEVPLEVVAFPRGTQTVATVQSDM 667
            .||:.:::..||  .||...:::|:...|..:       |.||...|            .::..:
Zfish   340 ALQNELDKTKDL--SLKRRGKDVQKSEKRTPQ-------TPTEEENE------------DLKCQL 383

  Fly   668 STSVENLVTSNVAVTQTDFEVPDRNVSIERETMSSPFAGLFPPSSSSRVGQSGSLLFPSAISHVL 732
            :...|..|.....:.:.|.| .||   :|:|...                              .
Zfish   384 AFIKEEAVLMRKKMAKIDKE-KDR---LEQELQK------------------------------Y 414

  Fly   733 LSGAGRKLSPTPHPHRLAPEVHADRDEGISDEDDPAELRILLELNEQEASILRLKVEDLEKENAE 797
            .|..|...||.|......|....:           :||::.|.|.|:||:||..|:.:||.||  
Zfish   415 RSFYGDVDSPLPKGEAGGPPTTRE-----------SELKLRLRLVEEEANILGRKIVELEVEN-- 466

  Fly   798 SKKYVRELQAKLRQDSSNGSKSSLLSLGTSSSAAEKKVKTLNEELVQLRRTLTEKEQTVDSLKNQ 862
                 |.|:|:|  |...|.:       .:..||:...:..:|.|.:||:.|...|...:.|:..
Zfish   467 -----RGLKAEL--DDLRGDE-------LTGGAADSSSREQSEALSELRQQLQLVEDEAELLRRN 517

  Fly   863 LSKLDTLETENDKLAKENKRLLALRKASEKTGE----------VD----QKMKESLAQAQRERDE 913
            |:   .:|.:|.|:..|      |.|...|.|.          ||    :.::|.|..|:.:.:|
Zfish   518 LA---DVEEQNTKMTSE------LNKLKYKAGSHEGSRYSSSAVDGAKLEALQEELKAARLQINE 573

  Fly   914 LTARLKRMQLEAEDKL------------------PPRTAKRVND------------LTPKSHLKK 948
            |:.::  |||:.|:::                  .||.:...:|            |||  |.|:
Zfish   574 LSGKV--MQLQYENRVLLSNMQRYDLASHLGIRGSPRDSDAESDCGRRESDDDCSRLTP--HRKR 634

  Fly   949 ----WVEELEDEISEMRVMLSSSGTDQLKALQSAKGALEEDLRKCKQKLSLAEGDVQRL-----K 1004
                ..|...:|:..:|.:..:      ::|.:.:|.......|.:|::.....:.:||     :
Zfish   635 EGPVGGESDSEEVRNIRCLTPT------RSLYTPEGRFLSRSFKDRQQMIDIRMEAERLSRTIDR 693

  Fly  1005 LLNGSSSKVSELEQKLKRGDEEAKKLNSKLKDLED--KVKKQEAQLKLGETSKSTWESQSKREKE 1067
            |:..:|:.::|....|..|:     |..:|.|.|:  ::::.|...::        .:|.|..::
Zfish   694 LIADTSTIIAEARVYLNNGE-----LFGRLDDEEEGGRIREHELLYRI--------NAQMKAFRK 745

  Fly  1068 KLSSLEKDMEKQAKEKEKLEAKISQLDAELL 1098
            :|.:....:|....|..:.|..:|.....:|
Zfish   746 ELQNFIDRLEVPKPEDRESEEPLSMFQPIIL 776

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18304NP_001260170.1 Smc 404..1202 CDD:224117 159/751 (21%)
CENP-F_N 1012..1286 CDD:287456 16/90 (18%)
ATP-synt_B <1180..1231 CDD:304375
LCD1 1485..>1594 CDD:286837
soga3XP_005157901.1 Herpes_ICP4_C 16..>147 CDD:332854 30/136 (22%)
SMC_N <205..574 CDD:330553 114/482 (24%)
SOGA 375..469 CDD:314335 30/158 (19%)
SOGA 496..588 CDD:314335 26/103 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4787
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000945
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.