DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rat1 and exo2

DIOPT Version :8

Sequence 1:NP_001260166.1 Gene:Rat1 / 33964 FlyBaseID:FBgn0031868 Length:908 Species:Drosophila melanogaster
Sequence 2:NP_593482.1 Gene:exo2 / 2542204 PomBaseID:SPAC17A5.14 Length:1328 Species:Schizosaccharomyces pombe

Alignment Length:730 Identity:285/731 (39%)
Similarity:388/731 (53%) Gaps:148/731 (20%)


  Fly     1 MGVPAFFRWLSRKYPSVIIECNENKQVDADTGRNIYEDPTLPNPNGIEFDNLYLDMNGIIHPCTH 65
            ||:|.||||:|.:||.    |::           :.|:..:|     ||||||||||||:|.|||
pombe     1 MGIPKFFRWMSERYPL----CSQ-----------LIENDRIP-----EFDNLYLDMNGILHNCTH 45

  Fly    66 PED--KPAPKNEDEMMVAIFECIDRLFGIVRPRKLLYMAIDGVAPRAKMNQQRSRRFRAAKETTE 128
            ..|  ...|..|:||.:|||..|:.||..::|:||||||:||.|||||||||||||||.||:..:
pombe    46 KNDDHSSPPLPEEEMYIAIFNYIEHLFEKIKPKKLLYMAVDGCAPRAKMNQQRSRRFRTAKDAHD 110

  Fly   129 KRLEIARIREELLSRGCKLPPEKEKGEHFDSNCITPGTPFMDRLSKCLHYFVHDRQNNNPAWKGI 193
            .||:..|..|:.        ||    |.||||||||||.||:|:|:.|:||:|.:..|:..|:.|
pombe   111 ARLKAERNGEDF--------PE----EQFDSNCITPGTTFMERVSRQLYYFIHKKVTNDSQWQNI 163

  Fly   194 KVILSDANVPGEGEHKIMDYIRKQRAQPDHDPNTQHVLCGADADLIMLGLATHEPNFTIIREEFL 258
            :||.|..:.|||||||||:|||.|:|||.::|||:|.|.|.|||||||||.:|:|:|.::|||..
pombe   164 EVIFSGHDCPGEGEHKIMEYIRTQKAQPSYNPNTRHCLYGLDADLIMLGLLSHDPHFCLLREEVT 228

  Fly   259 PNKPRPCDICNGFGHEMDKCVGLGATAPTSANFKPDVPIGAEVKFIFVRLSVLREYLKQTLE--M 321
                        ||             |.|.|...::   |..||..:.||:|||||:...:  .
pombe   229 ------------FG-------------PASRNRSKEL---AHQKFYLLHLSLLREYLEFEFQECR 265

  Fly   322 PNLPFEYSFERALDDWVFMCFFVGNDFLPHLPSLEIREGAVDRLVELYKKCVYKTRGYLTDSGDV 386
            ....|:|..|:.|||::.:.||||||||||||.|.|.|||:..:..:|||.:....||:.:.|.:
pombe   266 STFTFKYDLEKILDDFILLAFFVGNDFLPHLPGLHINEGALALMFSIYKKVMPSAGGYINEKGVI 330

  Fly   387 NLDRVQLIMTDLGNAEDQIFKSRQRREEQFKARDKARKRQERNQDHGSLNQSAFGASAVGPNSQQ 451
            |:.|::||:.:|.|.|.:|||:           :.:..:...|.|..|.:...:...:.  |..:
pombe   331 NMARLELILLELENFEKEIFKA-----------EVSETKNNGNSDKPSFDFLKYITEST--NDIK 382

  Fly   452 RSVGNYKEEAAALRN-----------------------RKRTSDM-------------------- 473
            ...|..|.....::.                       |:..:|:                    
pombe   383 AMTGEQKNYFLQIKKFLSSREPFIDFSANISSVDQRFLRRLCNDLHLSFSKIIKVDGTHLLRITF 447

  Fly   474 --ANLDDEDEEE------------------NNDEVRLWEDG-------FKDRYYESKFDVAPGNQ 511
              ...:||||:|                  .|:|..|.|..       :||.||.||...:..::
pombe   448 RDLEFNDEDEDEIEQDEIERVLQKYDNIPLLNEEQALKEKNVEKDFIQWKDDYYRSKVGFSYYDE 512

  Fly   512 QFRYAVALQYVRGLCWVLKYYYQGCASWNWYFPYHYAPFASDFVNIQGLSTMFEKGTKPFNPLEQ 576
            :...|:|.:||.||.|||.|||:||.||.||:.||:||..||.:....:...|:.|| ||.|.||
pombe   513 EALKAMAERYVEGLQWVLFYYYRGCQSWGWYYNYHFAPKISDVLKGLDVKIDFKMGT-PFRPFEQ 576

  Fly   577 LMGVFPAASSSHVPEPWAKLMSDPESPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKRLFKAL 641
            ||.|.||.|.:.||..:..||.:.||||||||||:|.:|.|||..:|:.|.::||:||.||..||
pombe   577 LMAVLPARSQALVPPCFRDLMVNSESPIIDFYPENFALDQNGKTASWEAVVIIPFIDETRLIDAL 641

  Fly   642 VPYYDQLTGEEVKRN 656
            ......||.||.|||
pombe   642 ASKDKFLTEEERKRN 656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rat1NP_001260166.1 XRN1 1..735 CDD:227382 285/731 (39%)
XRN_N 1..255 CDD:281193 132/256 (52%)
exo2NP_593482.1 XRN1 1..932 CDD:227382 285/731 (39%)
XRN_N 1..225 CDD:281193 132/256 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126774
Panther 1 1.100 O PTHR12341
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.