DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k09022 and HEATR1

DIOPT Version :8

Sequence 1:NP_609079.2 Gene:l(2)k09022 / 33960 FlyBaseID:FBgn0086451 Length:2096 Species:Drosophila melanogaster
Sequence 2:NP_060542.4 Gene:HEATR1 / 55127 HGNCID:25517 Length:2144 Species:Homo sapiens

Alignment Length:2268 Identity:637/2269 (28%)
Similarity:1059/2269 (47%) Gaps:301/2269 (13%)


  Fly     3 TALAQQLQKLAAPQSSVTLADARSRASILFDPKEAATKDRRSIYEIGLTGLQELTDFNPAFKEFQ 67
            |:||||||:||.|||..:|......||:|||||||||.||.:.:.||.|||:||...:|:|::|:
Human     2 TSLAQQLQRLALPQSDASLLSRDEVASLLFDPKEAATIDRDTAFAIGCTGLEELLGIDPSFEQFE 66

  Fly    68 LTLFDEATLTLERSVELPEINKMLDAAIAKFLRLLSPYLLLRPAHMAFEWLLRRFQVHEYNRSEV 132
            ..||.:...||||||:...:||.||..|:.||..||||.||:||....|||:.||.:|.||:..:
Human    67 APLFSQLAKTLERSVQTKAVNKQLDENISLFLIHLSPYFLLKPAQKCLEWLIHRFHIHLYNQDSL 131

  Fly   133 MALILPYHETMIFVQIVKTMRLRSSDGDWYWLRPLQRPGVPLAKTAIINRAASNPAFLGFICQST 197
            :|.:||||||.|||::::.:::.:|...|:||.|:::.||||||..:|.....:..|:.|||...
Human   132 IACVLPYHETRIFVRVIQLLKINNSKHRWFWLLPVKQSGVPLAKGTLITHCYKDLGFMDFICSLV 196

  Fly   198 QKAVK---ELGPRAHQLQAQINFYATVVVGALQTAKPLQDWHITTILESLLRGLISDNIDFMAAA 259
            .|:||   |....:.||:..:.|||:.:|.||..|:.:.|..|..:...:.:||.|...|:.||.
Human   197 TKSVKVFAEYPGSSAQLRVLLAFYASTIVSALVAAEDVSDNIIAKLFPYIQKGLKSSLPDYRAAT 261

  Fly   260 YVIVAQLVSRTKLKSKVCNALLERVAN--CPFERLHSESLLLLVCIYGKQ------QAALPHF-- 314
            |:|:.|:..:..:::...|:|..::..  .....|..:.|..|:.:..:|      :...||.  
Human   262 YMIICQISVKVTMENTFVNSLASQIIKTLTKIPSLIKDGLSCLIVLLQRQKPESLGKKPFPHLCN 326

  Fly   315 KPE--TILNLVGKKWLISTLSSLAKGNIAIQSICMPLMTGAVAAIRDDDASSNSCKLFLDNLLSE 377
            .|:  |||:.:.:.:.:|.|......::.:..|      ..|.....:.......|..|:.:|::
Human   327 VPDLITILHGISETYDVSPLLHYMLPHLVVSII------HHVTGEETEGMDGQIYKRHLEAILTK 385

  Fly   378 VPMPKPTAQQLINCFLDTYVETAIDAPEPMETNSNEDDDTIVIDSDDEIETEKTT-FQAWYSTYL 441
            :.:.......|.:...:.|:.                     ..|.:|:::.|.: ....:...:
Human   386 ISLKNNLDHLLASLLFEEYIS---------------------YSSQEEMDSNKVSLLNEQFLPLI 429

  Fly   442 EKLERRYPEAFDLSVKEALRSKSSTSNRQKALKLALGFRLNTTDEKAKHAYEKLYHYSADWRLSA 506
            ..||.:||...|:.::|.|:..:....::...:..   .|:|:..|        |.:.||...|.
Human   430 RLLESKYPRTLDVVLEEHLKEIADLKKQELFHQFV---SLSTSGGK--------YQFLADSDTSL 483

  Fly   507 VQKL--------------LQNLNVTKKRERSVKLLQECLPDRINDDSGAVVSTLLSLPTEELAEM 557
            :..|              |:.:..|.|.......::|.:..|:.||:..||.:.:| ..|...|.
Human   484 MLSLNHPLAPVRILAMNHLKKIMKTSKEGVDESFIKEAVLARLGDDNIDVVLSAIS-AFEIFKEH 547

  Fly   558 LGPLPLAQTLCHLLYRAQSEKDEEWQPVVPLAVRHLTSALVSGSYD--TNLVLLALMPLLFPGEA 620
            .........|.:|..||:..|:.||..|:.:|...|....:....|  :|.|::.|:|.:.....
Human   548 FSSEVTISNLLNLFQRAELSKNGEWYEVLKIAADILIKEEILSENDQLSNQVVVCLLPFMVINND 612

  Fly   621 LAEHQHKALRILLG-SDFVSKVPFLA--ELKVSNKFSDFN----VGEHRQHFLDIIASSNQELSS 678
            ..|.....:.|.|. |...|..|.|.  |..:.|......    :|...|..::::| .|..|..
Human   613 DTESAEMKIAIYLSKSGICSLHPLLRGWEEALENVIKSTKPGKLIGVANQKMIELLA-DNINLGD 676

  Fly   679 QERALLQSVED---HGGELYIQKASQLT-HLLLLLTAYAKRELQPRESLHMLEKIGLYSRRLQ-- 737
            .. ::|:.|||   .|.|.......::| |::|.:.......|:.......:....|..::::  
Human   677 PS-SMLKMVEDLISVGEEESFNLKQKVTFHVILSVLVSCCSSLKETHFPFAIRVFSLLQKKIKKL 740

  Fly   738 FRVVNGSQNTQNCAPLQLYVDFLLTL-VKNTKWT----ALASTPWNQMTDELRLCLRLLEIICAQ 797
            ..|:...:     .|.:.:::.:|.. :....|.    .|.||....:.|.:.|...|.:.|   
Human   741 ESVITAVE-----IPSEWHIELMLDRGIPVELWAHYVEELNSTQRVAVEDSVFLVFSLKKFI--- 797

  Fly   798 VFSEKADQ--PERQEWTRALQQSLQLILPEAQDRLEVLSN------------------------- 835
             ::.||.:  |:...|....|     :..:::|.|.:|..                         
Human   798 -YALKAPKSFPKGDIWWNPEQ-----LKEDSRDYLHLLIGLFEMMLNGADAVHFRVLMKLFIKVH 856

  Fly   836 ----FYVFERLPELWPRDSDYA---------VFRLQGFIILEAVLSNPKSQ-------IDCGLVH 880
                |.:|:....||...|..:         |.:.|...:..|:||:.|:|       |...:|.
Human   857 LEDVFQLFKFCSVLWTYGSSLSNPLNCSVKTVLQTQALYVGCAMLSSQKTQCKHQLASISSPVVT 921

  Fly   881 VLRVANACGSPLQTLRVQAINILQLISNRKLVSHVEQLVRSLLQRKSELSMDHE---QYALILYT 942
            .|.:  ..|||::.:|..||..||.:|.  :.|....::..|:.:..|::.|..   |....|:.
Human   922 SLLI--NLGSPVKEVRRAAIQCLQALSG--VASPFYLIIDHLISKAEEITSDAAYVIQDLATLFE 982

  Fly   943 ILEPEKATAKERLVLSKLKRSVLALASDPKQSPICTASLLAALKHVNDENFLNELLPLGLDSLKT 1007
            .|:.||.....:.:...||..:..:.|.|.   .....|:..|:.||.|..|::|||:....|  
Human   983 ELQREKKLKSHQKLSETLKNLLSCVYSCPS---YIAKDLMKVLQGVNGEMVLSQLLPMAEQLL-- 1042

  Fly  1008 ITAGEDNQNIKQLPWPHSEIYKSVIERFEGRVALNVLLRK--DLAWKLFEDSFAQYDTYV----- 1065
                   :.|::.|        :.:.:.|..| |::.|.|  :.:..|..:.....|.::     
Human  1043 -------EKIQKEP--------TAVLKDEAMV-LHLTLGKYNEFSVSLLNEDPKSLDIFIKAVHT 1091

  Fly  1066 --QLEQKLQPLPCVLLNSLTPETF-----EQMHAKHKIALIKLIVESATNSDN-------DSIFL 1116
              :|...:..:....|..:|...|     |::..|    |::::.:...|..|       .|:|.
Human  1092 TKELYAGMPTIQITALEKITKPFFAAISDEKVQQK----LLRMLFDLLVNCKNSHCAQTVSSVFK 1152

  Fly  1117 ASHRLLKRCRLDCQPLVPILLEMANT----KVEKKQPVKRRSVQATQLDLTSPYWKQGMTLLELL 1177
            ......::.|::.:|  |...:...|    :.:|.|..|.:.:::.| ::...||::...:||||
Human  1153 GISVNAEQVRIELEP--PDKAKPLGTVQQKRRQKMQQKKSQDLESVQ-EVGGSYWQRVTLILELL 1214

  Fly  1178 EHKKQLVGAELLIPPLFELLQACL--TMEEHSAAEYPKQLILSSLLHCCQTAQSAGVQLVK-AMP 1239
            :|||:|...::|:|.||.||..||  ..:|....||.||||||.||:.||.....|.::.| .:.
Human  1215 QHKKKLRSPQILVPTLFNLLSRCLEPLPQEQGNMEYTKQLILSCLLNICQKLSPDGGKIPKDILD 1279

  Fly  1240 ESSFRIELVVQSLRNTRNPQTQQHALLFLTHCAGMYPQQVLHKIVEIFTFVGSTVARHDDAFSLH 1304
            |..|.:||:||.:|.:..|||..||||.|...||::|.:|||.|:.||||:|:.|.|.||.:|..
Human  1280 EEKFNVELIVQCIRLSEMPQTHHHALLLLGTVAGIFPDKVLHNIMSIFTFMGANVMRLDDTYSFQ 1344

  Fly  1305 IIHNVVESIIPILL-------LNTGHN--ELVIPVLKVFADICTDVPVHRRLPLYATLFRVLEPK 1360
            :|:..|:.:||.|:       :....|  |:|:.::.||.|....||.|||||:...|...|..:
Human  1345 VINKTVKMVIPALIQSDSGDSIEVSRNVEEIVVKIISVFVDALPHVPEHRRLPILVQLVDTLGAE 1409

  Fly  1361 EHLWQFLCIIFE----SQVLLEQVPQKVSTDKSRLDF----ARELTLMFEDPTVAIQTCIRLLDY 1417
            :.||..|.::||    ..||.....:|.:..::..:|    ..|.::..:     ||:.:.:|.|
Human  1410 KFLWILLILLFEQYVTKTVLAAAYGEKDAILEADTEFWFSVCCEFSVQHQ-----IQSLMNILQY 1469

  Fly  1418 LAKLPATKSSLSGGSGSSVLSTEQ----QLFDVRTRTFKQLRHYKYLIMDFLSGISSCNEWEKKM 1478
            |.|||..|......:.|...|..|    |:|:|.|.|.|||||:|:|.:.|:|.:.|.|.:.||:
Human  1470 LLKLPEEKEETIPKAVSFNKSESQEEMLQVFNVETHTSKQLRHFKFLSVSFMSQLLSSNNFLKKV 1534

  Fly  1479 KRPDPNELLPYYQEFILKT-LAYVGVLNGALEAASETPSLEKFWRVLANHAHDVLDNAIGLLAPQ 1542
            ......|:|...:|.:|:| |.|:..:..::|..::..:: ||||.|.:.|:|:||....||..:
Human  1535 VESGGPEILKGLEERLLETVLGYISAVAQSMERNADKLTV-KFWRALLSKAYDLLDKVNALLPTE 1598

  Fly  1543 HFISVITELLKHDHVYVRIKVMDLLVTKLSPSSDYFQQSNAEHFGVLFAPLQEIINGILEGSSNS 1607
            .||.||..|:.:....||.|.:|||..||..:..: :::....|..|...|..|:.  .:.....
Human  1599 TFIPVIRGLVGNPLPSVRRKALDLLNNKLQQNISW-KKTIVTRFLKLVPDLLAIVQ--RKKKEGE 1660

  Fly  1608 AQQAKLQQTALHALQLLALRHGRDYIEECRSLLATLTKITKRRANVPKAVVGNVVLTLVEICASL 1672
            .:||..:||||:.|:||....|.:..:....:|.|..|:........|.|:|:.:|.:.|:.::|
Human  1661 EEQAINRQTALYTLKLLCKNFGAENPDPFVPVLNTAVKLIAPERKEEKNVLGSALLCIAEVTSTL 1725

  Fly  1673 KAHALAQLPKFAPQL-------TELLKEQVHQMASLKQGPDYVCSTLVTALHKLFKALPLFLGPY 1730
            :|.|:.|||...|.|       :||:..:|:.:::|            .||.|:.:.||.|:.||
Human  1726 EALAIPQLPSLMPSLLTTMKNTSELVSSEVYLLSAL------------AALQKVVETLPHFISPY 1778

  Fly  1731 LVDIIGGLARL--------SVQLENPQLLQDKRTQVLKQKLADVWSAVAQGVEVRILVPSCAKAF 1787
            |..|:..:..|        |....|.:|...|:|             :|..:..|:|:|:..|.:
Human  1779 LEGILSQVIHLEKITSEMGSASQANIRLTSLKKT-------------LATTLAPRVLLPAIKKTY 1830

  Fly  1788 SSLLEQQAYDELGHLMQQLLLQSVRHNSAAQLQPVQDPLSELFLQALNFRLQVRGLGLQRQLVSD 1852
            .. :|:...:.:|..| .:|.:.:......:|...|..|:..||:||:||.|.....|:.  |..
Human  1831 KQ-IEKNWKNHMGPFM-SILQEHIGVMKKEELTSHQSQLTAFFLEALDFRAQHSENDLEE--VGK 1891

  Fly  1853 VEASITETFVTWILKLSETSFRPMYSRVHKWA-LESTSRETRLTYFLLTNRIAEALKSLFVLFAS 1916
            .|..|.:..|..::||||.:|||::.::..|| .|...::..||::.|.:.|||.||.||.|||.
Human  1892 TENCIIDCLVAMVVKLSEVTFRPLFFKLFDWAKTEDAPKDRLLTFYNLADCIAEKLKGLFTLFAG 1956

  Fly  1917 DFVEDSSRLLTEHNSIRPEFEVEEREDDVD----LLMAILNTLHHVFLYCSEDFINDHRFNVLMP 1977
            ..|:..:..|.:.|..:.:....:.|:|.:    ||..|||.|:.:||:.::.||:..|...||.
Human  1957 HLVKPFADTLNQVNISKTDEAFFDSENDPEKCCLLLQFILNCLYKIFLFDTQHFISKERAEALMM 2021

  Fly  1978 PLVNQLENDLVLGNESLQQVLSN----CIAQFAVA-TNDVMWKQLNSQVLLKTRTSNPEVRILAF 2037
            |||:||||.|. |.|..|:.::.    |||||:|| .:|.:||.||.|:|||||.|:|:||..|.
Human  2022 PLVDQLENRLG-GEEKFQERVTKHLIPCIAQFSVAMADDSLWKPLNYQILLKTRDSSPKVRFAAL 2085

  Fly  2038 NSCVAIARKLGESYAALLPETVPFIAELLEDEHQRVEKNTRTGVQELETILGESVQKY 2095
            .:.:|:|.||.|:|..||||::||:|||:|||.:.||...:..:|:|||:|||.:|.|
Human  2086 ITVLALAEKLKENYIVLLPESIPFLAELMEDECEEVEHQCQKTIQQLETVLGEPLQSY 2143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)k09022NP_609079.2 U3snoRNP10 236..350 CDD:289183 25/126 (20%)
BP28CT 1818..1966 CDD:214987 51/153 (33%)
HEATR1NP_060542.4 U3snoRNP10 238..354 CDD:289183 24/116 (21%)
BP28CT 1857..2010 CDD:214987 51/155 (33%)
HEAT 2106..2142 18/36 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C367160110
eggNOG 1 0.900 E1_KOG1837
Hieranoid 1 1.000
Homologene 1 1.000 H34562
Inparanoid 1 1.050 711 1.000 Inparanoid score I634
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D50761at33208
OrthoFinder 1 1.000 FOG0003557
OrthoInspector 1 1.000 T1074440
orthoMCL 1 0.900 OOG5_129117
Panther 1 1.100 LDO PTHR13457
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1613
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.