| Sequence 1: | NP_609076.3 | Gene: | CG17375 / 33956 | FlyBaseID: | FBgn0031861 | Length: | 268 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001262333.1 | Gene: | CG31248 / 40853 | FlyBaseID: | FBgn0051248 | Length: | 251 | Species: | Drosophila melanogaster | 
| Alignment Length: | 144 | Identity: | 27/144 - (18%) | 
|---|---|---|---|
| Similarity: | 46/144 - (31%) | Gaps: | 47/144 - (32%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly   103 VFFPSSLP--------RNLFQQIIMMKKELIDATKANMGISTYDALFVHEIAFPDELYFNRDFLS 159 
  Fly   160 TIFDVFGFVAQHMHMPRVSFIALSSVDQEAASLIDYEEIGRTIYSIYKVGNTRPFDILRELDEMY 224 
  Fly   225 ALLFELAVSPVLKY 238  | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR20905 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||