powered by:
Protein Alignment CG17375 and R05H10.7
DIOPT Version :9
Sequence 1: | NP_609076.3 |
Gene: | CG17375 / 33956 |
FlyBaseID: | FBgn0031861 |
Length: | 268 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001022271.1 |
Gene: | R05H10.7 / 3565038 |
WormBaseID: | WBGene00011046 |
Length: | 226 |
Species: | Caenorhabditis elegans |
Alignment Length: | 51 |
Identity: | 15/51 - (29%) |
Similarity: | 21/51 - (41%) |
Gaps: | 2/51 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 PDELYFNRDFLSTIFDVFGFVAQHMHMPRVSFIALSSVDQEAASLIDYEEI 198
|:||.:.....|...||..|:.:|.........||..:..||..| ||.:
Worm 2 PEELIYRLAKKSDAPDVLNFLLEHYFPLEPCTRALKLIKSEAEVL--YESL 50
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17375 | NP_609076.3 |
None |
R05H10.7 | NP_001022271.1 |
Acetyltransf_7 |
<134..184 |
CDD:316066 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR20905 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.