DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17375 and R05H10.7

DIOPT Version :9

Sequence 1:NP_609076.3 Gene:CG17375 / 33956 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001022271.1 Gene:R05H10.7 / 3565038 WormBaseID:WBGene00011046 Length:226 Species:Caenorhabditis elegans


Alignment Length:51 Identity:15/51 - (29%)
Similarity:21/51 - (41%) Gaps:2/51 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PDELYFNRDFLSTIFDVFGFVAQHMHMPRVSFIALSSVDQEAASLIDYEEI 198
            |:||.:.....|...||..|:.:|.........||..:..||..|  ||.:
 Worm     2 PEELIYRLAKKSDAPDVLNFLLEHYFPLEPCTRALKLIKSEAEVL--YESL 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17375NP_609076.3 None
R05H10.7NP_001022271.1 Acetyltransf_7 <134..184 CDD:316066
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.