DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17375 and AANATL3

Sequence 1:NP_609076.3 Gene:CG17375 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_610018.1 Gene:AANATL3 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster

Alignment Length:244 Identity:49/245 (20%)
Similarity:87/245 (36%) Gaps:63/245 (26%)


  Fly    17 EGMQIVDINSKYYDMVIEFMWSNSFLKSLVYESLG-LFDLPDMKQTYSWYVRHILRNECSVMMIS 80
            :|:.|..:..:.|..|..|:..|.|....:.:|.. .....:.|:...:::..|.:..|   :::
  Fly     7 DGITIRTMTKEDYPSVKAFLKDNFFQSEPLCQSTSENVQSQNEKENDEYHLSMIAQGTC---LVA 68

  Fly    81 EDETQ-IRAVGL---------------LEWMTEEWHSWV---FFPSSLPR--NLFQQIIMMKKEL 124
            .||:. .:.|||               :|..:.|.|.|.   ...|.:.|  |||::        
  Fly    69 IDESNGGKFVGLVLAGAQYPEDLEKHRIEAESMEQHFWARACIMLSKIEREANLFER-------- 125

  Fly   125 IDATKANMGISTYDALFVHEIAFPDELY---FNRDFLSTIFDV---FGFVAQHMHMPRVSFIALS 183
                   .|||  ..|:.|..:....:.   ......:|:.||   .||.|...:.  .||  .|
  Fly   126 -------FGIS--KLLYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYC--TSF--YS 177

  Fly   184 SVDQEAASLIDYEEIGRTIYSI----YKVGNTRPFDILRELDEMYALLF 228
            :..:||..:       :.::|:    ||....||.....|...|..::|
  Fly   178 ARQKEALGM-------KCVHSLPYADYKDDQGRPIFTPAEPHTMARIMF 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17375NP_609076.3 None
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 16/81 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.