DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17375 and AANATL2

Sequence 1:NP_609076.3 Gene:CG17375 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001285667.1 Gene:AANATL2 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster

Alignment Length:179 Identity:32/180 (18%)
Similarity:75/180 (42%) Gaps:47/180 (26%)


  Fly    57 DMKQTYSWYVRHILRNECSVMMISEDETQIRAVGLLEWMTEEWHSWVFFPSSLPRNLFQQIIMMK 121
            |.::..::...|..:.| .:|:|.:::.:...|...|   .|.|.     |.:|::|  .::.:.
  Fly    13 DYEEVEAFLAVHFFKQE-PLMLIPQEDPKQSEVSSAE---AELHR-----SLIPQDL--SLVAVD 66

  Fly   122 KELIDATKANMGISTYDALFVHEIAFPDELYFNRDF-------LSTIFD-VFGFVA--------- 169
            .|.|      :|:     :...|:. |::|  .|::       ::.:.| :..|:|         
  Fly    67 GERI------VGV-----VLAGELV-PEDL--EREYQEAEQKEITCLLDKIHKFLAGIERQANIF 117

  Fly   170 QHMHMPRVSFIALSSVDQEAASLIDYEEIG-RTIYSIYKVGNTRPFDIL 217
            :|..:.|..::.:..||..    |..:.:| |.:.:..::|..|.|.::
  Fly   118 KHYGVERALYLYMLGVDVS----IRRQRVGTRLVEATIELGRQRGFPVV 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17375NP_609076.3 None
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 10/54 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.