DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17375 and T10B5.4

DIOPT Version :10

Sequence 1:NP_609076.3 Gene:CG17375 / 33956 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001300192.1 Gene:T10B5.4 / 178668 WormBaseID:WBGene00020390 Length:237 Species:Caenorhabditis elegans


Alignment Length:88 Identity:19/88 - (21%)
Similarity:32/88 - (36%) Gaps:22/88 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ELYFNRDFLSTIFDVFGFVAQHMHMPR-------------VSF---IALSSVDQEAASLI--DYE 196
            ||.|....|.....|..|:.:|..:..             ..|   :.:|.::.|.:|::  |.|
 Worm     3 ELTFQTGLLEHKDQVHKFLVEHFRVMEPITTSLSCSEEDVAEFFVDLTMSGLEDEKSSILVFDGE 67

  Fly   197 EIGRTIYSIYK----VGNTRPFD 215
            ||.....:..|    |..:.||:
 Worm    68 EIVAVCLNAVKECSFVSESTPFN 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17375NP_609076.3 None
T10B5.4NP_001300192.1 Acetyltransf_1 <110..187 CDD:395465
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.