DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17375 and R05H10.1

Sequence 1:NP_609076.3 Gene:CG17375 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_497076.1 Gene:R05H10.1 WormBaseID:WBGene00011042 Length:250 Species:Caenorhabditis elegans

Alignment Length:59 Identity:14/60 (23%)
Similarity:20/60 (33%) Gaps:23/60 (38%)


  Fly   205 IYKVGNTRPFD-ILRELDEMYALLFELAVSPVLKYIEMPGFEEFHEALDARLAKEAAEK 262
            ||:......|| ||:.|.|.:                      :||....|.:|.|.|:
 Worm     6 IYRTAEKSDFDRILKFLAEHF----------------------YHEEPSIRASKIALEE 42



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.