DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and PBY1

DIOPT Version :8

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_009652.2 Gene:PBY1 / 852391 SGDID:S000000298 Length:753 Species:Saccharomyces cerevisiae

Alignment Length:707 Identity:139/708 (20%)
Similarity:253/708 (36%) Gaps:185/708 (26%)


  Fly    21 PVSKIQSLIHNLDAELVQLCKQCSVQKPLTSLNNSTSLGSHFSNFGALGGGSGSKTMGGSSSM-- 83
            |.|.....:|.|..|...|.    :..|....|.|   .::.::.|.:||...|...|.:.::  
Yeast   112 PASCANIGLHLLSNEPFDLV----LSGPNVGRNTS---AAYITSSGTVGGAMESVITGNTKAIAI 169

  Fly    84 ------GSNNFSPDSIGNLLARVRASTPL-----------PRTVTSSPTAPEAQK-RQMRNVYRT 130
                  |..|.||     ||....:...|           |:|...|...|..:. .....||..
Yeast   170 SWAYFNGLKNVSP-----LLMEKASKRSLDVIKHLVKNWDPKTDLYSINIPLVESLSDDTKVYYA 229

  Fly   131 RVIDAYRNRRIFTVYGNYHTVRRAL-----------MRRGWLEKLPASRHA--KLQSMSEDALLE 182
            .:   :.||.|....|.:..:..:.           :...|..|..|.:.:  .:....:..:|.
Yeast   230 PI---WENRWIPIFNGPHINLENSFAEIEDGNESSSISFNWAPKFGAHKDSIHYMDEYKDRTVLT 291

  Fly   183 HARRGNDYEAVVISKMINHFP--AFFIWQGKGQRDLCAEVRPFRNRVRRSQFLDFSTKVGLVGCA 245
            .|.       |:.|:||:..|  |.|    ||...|..|::    .......|..:..:.:|...
Yeast   292 DAE-------VIESEMISVTPMKATF----KGVNHLLGELK----LTEEENNLSKTNNLIVVSID 341

  Fly   246 EQERWYREDGVCGMSY----------PRFYRLGGNNLEERMAFIEDYQQTQARSLLLYVREHQPA 300
            ..|..|:........|          |.|.. ||...|.::....||:|.....|:         
Yeast   342 PMEYIYKPLTHALKKYLPQVEIVSNLPEFDN-GGCEKEMKVFHYGDYEQLDMDKLM--------- 396

  Fly   301 ELISENGTIFSTTLDFALGKVKKMVRHAEHYSLDDARIKPPTPAEIVENQTFMVQSTDVLKSNAK 365
            ||   ....|:.:..:....::|   |...:::                ||:..::.:.:...| 
Yeast   397 EL---PNNYFTNSYIYRKALIRK---HFLSHTI----------------QTYTAKNPESILKKA- 438

  Fly   366 FKVSEKVMAEYARLAGLYLDQIESLRPDYRWDGSRNLWILKPGYQSRGIGIVIRSSLDDIL---- 426
            :..|..:..:||......||:...||.:...:.....||:||....:|.||.:..:::|:.    
Yeast   439 YLESFTIDLDYAEFLDDALDENWELRQELENESQDKWWIVKPSMSDKGQGIRVFKTIEDLQAIFD 503

  Fly   427 -----------------------QWTSNN-----QNKKYIVQKYIERPLLIY---RTKFDIRQYM 460
                                   ::..||     |.:.:|:|:|:..|||:.   ..||.||.|:
Yeast   504 SFDDEDSEAEESGNDDDADDVNGEFMDNNKVNISQLRHFIIQEYLTNPLLLASMDNRKFHIRCYV 568

  Fly   461 LLTITDTKVSIWTYRDCYLRFSSQEF--------TMDDLRE-SIHLTNNSVQKRYKNKTNRDSRL 516
               :....:.::.|......|:::.|        ::.||:: ..||||..:|.:.|:|   ||.:
Yeast   569 ---VCRGDLQVFVYDRMLALFAAKPFVPLDPYAYSVTDLKDLECHLTNTCLQSKKKDK---DSSV 627

  Fly   517 PKNNMWSLDQFKNYLRIMGAPDGSWSKTYNGFKQNLVA----VVMASLDETEL----LQNAFELY 573
            .:.:  |:::..|             :..:..|:.:.:    |.:|:::...|    |.||||.|
Yeast   628 LEFD--SIEEIPN-------------ERKSNIKEQIHSITNDVFLAAVNVNRLNFQPLPNAFETY 677

  Fly   574 GCDFMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKD----CIRVVVDLPKNPT 626
            |.||::|.:|...|:|||:.||...:.:....:...:..|    |:..:.:..:|.|
Yeast   678 GVDFLIDSNYEVKLLEINAFPDFKQTGKDLKNLIDELFDDTVKYCVTPIFNENRNKT 734

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 73/357 (20%)
PBY1NP_009652.2 surE 1..311 CDD:272899 43/225 (19%)
TTL 389..732 CDD:281171 78/396 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1136511
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.615 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1567
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.