DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and TTLL1

DIOPT Version :8

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_036395.1 Gene:TTLL1 / 25809 HGNCID:1312 Length:423 Species:Homo sapiens

Alignment Length:420 Identity:103/421 (24%)
Similarity:176/421 (42%) Gaps:100/421 (24%)


  Fly   309 IFSTTLDFALGKVKKMVRH-AEHYSLDDARIKPPTPAEIVENQTFMVQSTDVLKSNAKFKVSEKV 372
            :||....:.|.. .::|.| ..||.|                     ...|::..|.| :..:::
Human    47 VFSVEAGYRLSD-DQIVNHFPNHYEL---------------------TRKDLMVKNIK-RYRKEL 88

  Fly   373 MAEYARLAG-------LYLDQIE---SLRPDYRW------DGSRNLWILKPGYQSRGIGIVIRSS 421
            ..|.:.||.       ||||.:.   .|..||..      ....:.||:||..:::|.||.:.:.
Human    89 EKEGSPLAEKDENGKYLYLDFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPCGKAQGKGIFLINK 153

  Fly   422 LDDILQWT---------SNNQNKKYIVQKYIERPLLIYRTKFDIRQYMLLTITDTKVSIWTYRD- 476
            |..|.:|:         |.:..:.|::..||..||||...|||:|.|:|::         |||. 
Human   154 LSQIKKWSRDSKTSSFVSQSNKEAYVISLYINNPLLIGGRKFDLRLYVLVS---------TYRPL 209

  Fly   477 -CYL------RFSSQEFT-----MDDLRESIHLTNNSVQKRYKNKTNRDSRLPKNNMWSLDQFKN 529
             ||:      ||.:.::|     :|::  .:||||.::||.     ..|........|::...:.
Human   210 RCYMYKLGFCRFCTVKYTPSTSELDNM--FVHLTNVAIQKH-----GEDYNHIHGGKWTVSNLRL 267

  Fly   530 YLRIMGAPDGSWSKTYNGFK----QNLVAVVMASLDETELLQNAFELYGCDFMLDEHYNPILIEI 590
            ||......:.: ||.::...    |:|.||.....::    ::.||.||.|.::|:...|.|||:
Human   268 YLESTRGKEVT-SKLFDEIHWIIVQSLKAVAPVMNND----KHCFECYGYDIIIDDKLKPWLIEV 327

  Fly   591 NSTPDLSPSTEITARICPMVLKDCIRVVV---DLP------KNPTAATGLFELAFEVNYSINKGA 646
            |::|.|:.||.....:...::.|.:.:.|   ::|      ..|....|.:|:.::...:...||
Human   328 NASPSLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGA 392

  Fly   647 DGKPLELNGKQ-MTLFENMPRMRNSPRTRL 675
            |   .||..:| .:|.....|.|:|.|..|
Human   393 D---RELRSRQGQSLGPRAGRSRDSGRAVL 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 86/353 (24%)
TTLL1NP_036395.1 TTL 59..364 CDD:281171 85/348 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1567
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.