DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31633 and CG14937

DIOPT Version :9

Sequence 1:NP_723199.1 Gene:CG31633 / 33931 FlyBaseID:FBgn0051633 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_609518.1 Gene:CG14937 / 34591 FlyBaseID:FBgn0032377 Length:445 Species:Drosophila melanogaster


Alignment Length:417 Identity:99/417 - (23%)
Similarity:165/417 - (39%) Gaps:99/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LNDDCVLKIVDYLDLEDQLKLWKSSEPASRLRSLISYIWQ-RNREYTIDYYTFNDDYELLNEF-- 68
            ||||.:..|:..||...|.::   |....||..::..:|: |.|...:....|........:|  
  Fly    17 LNDDVLALIIRQLDTYQQFQI---SRLNRRLAGVVHMLWETRVRNVVLQDEMFGRSGANSRQFVA 78

  Fly    69 -----------LQCIRFTVTELTLQYLAMDHLER-----WKGHTFPNMRQLIYLGDETSEIEGDA 117
                       |.|.:..|..|.|  |:...|||     |.|:.: ..|::.::         |.
  Fly    79 FILALAPHMQHLSCKQLDVRRLRL--LSNHTLERIHSFEWLGNVY-RRRRVRFV---------DE 131

  Fly   118 DIAILVDCFPQLEAIRLSG-KTTGNHISRWRNIRRLDLQLCWYLSPQGFEDICQNLRLQTLSIQW 181
            |:.:|...||.|::::|.| :.||.::.....:..|.|..|.:|..|.|.||.:.|||:...|..
  Fly   132 DVRMLQRVFPNLKSLKLRGCQITGKYLCDLDELTDLRLHDCHFLESQHFRDIFRQLRLRKFDIME 196

  Fly   182 QKIEQNAYVRSICMLHE------LEELEL-DI-VYLNRDNISQLLSLPKLIKLRLHNFYQVDDLL 238
            ...|.|.     |.|.:      ||.::: |. |.:..|...|||:||.|.||.:::...|.|:|
  Fly   197 DCDEVNC-----CDLADLQLCPTLEHIKIADYHVCMESDITQQLLTLPNLRKLSIYSRNFVFDVL 256

  Fly   239 CEIGSIR-----GQDVLTAAFSNNIWMRPTEVL-------AKLRNLRCLTLVD-----------D 280
            ..|.|..     |:.:...:||.        ||       .:|.||..||.::           :
  Fly   257 SRIVSPTSPPGDGRQIEAFSFSG--------VLHDYGRFFRELGNLSHLTRLELHSQPEEEEEKE 313

  Fly   281 EG----C--------AAIDFSTITYCFPLLEQLHLENSRIWVNADGIWDVLLACPRLREFSMINH 333
            ||    |        .|.....:|       :|||...:: .:..|:.:.::.|.:||...:...
  Fly   314 EGVQVQCLGDQILRQLASQLGELT-------ELHLCGYQL-ESPLGLLEFVINCRQLRVLDITRT 370

  Fly   334 VLYDEFFAFSKSTMNRALNQRTKPLKM 360
            ..:.|.|.:....:....:.|.:||::
  Fly   371 FCHGESFVWRCIAILAKQSWRIRPLEL 397



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012674
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.