DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf5a and RDS3

DIOPT Version :9

Sequence 1:NP_609038.1 Gene:Phf5a / 33909 FlyBaseID:FBgn0031822 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_015419.1 Gene:RDS3 / 856209 SGDID:S000006298 Length:107 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:58/105 - (55%)
Similarity:74/105 - (70%) Gaps:1/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICG-GP 64
            |::|..|||.|.|||||..|.||||.||||.||||||||...||:|:.|::|.....|:||. ..
Yeast     1 MSRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNV 65

  Fly    65 GVSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKK 104
            ||:||:||..|....||:||||:|:||||::.|..:|:||
Yeast    66 GVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKKK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf5aNP_609038.1 PHF5 1..104 CDD:397635 56/103 (54%)
RDS3NP_015419.1 PHF5 1..105 CDD:397635 56/103 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342084
Domainoid 1 1.000 130 1.000 Domainoid score I1138
eggNOG 1 0.900 - - E1_KOG1705
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7151
Inparanoid 1 1.050 130 1.000 Inparanoid score I1247
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53688
OrthoFinder 1 1.000 - - FOG0004100
OrthoInspector 1 1.000 - - oto99809
orthoMCL 1 0.900 - - OOG6_102593
Panther 1 1.100 - - LDO PTHR13120
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R611
SonicParanoid 1 1.000 - - X2842
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.