DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf5a and AT1G07170

DIOPT Version :9

Sequence 1:NP_609038.1 Gene:Phf5a / 33909 FlyBaseID:FBgn0031822 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001077473.1 Gene:AT1G07170 / 837228 AraportID:AT1G07170 Length:110 Species:Arabidopsis thaliana


Alignment Length:109 Identity:99/109 - (90%)
Similarity:104/109 - (95%) Gaps:0/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPG 65
            |||||||||.||||||:||||||||.|||||||||||||||||||||||||||:|||||||||.|
plant     1 MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSFQGRCVICGGVG 65

  Fly    66 VSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQ 109
            :|||||||.||.||||||||||||||||:||||||||||||||:
plant    66 ISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf5aNP_609038.1 PHF5 1..104 CDD:397635 93/102 (91%)
AT1G07170NP_001077473.1 PHF5 1..104 CDD:397635 93/102 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 215 1.000 Domainoid score I748
eggNOG 1 0.900 - - E1_KOG1705
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7151
Inparanoid 1 1.050 225 1.000 Inparanoid score I1177
OMA 1 1.010 - - QHG53688
OrthoDB 1 1.010 - - D1477492at2759
OrthoFinder 1 1.000 - - FOG0004100
OrthoInspector 1 1.000 - - otm2829
orthoMCL 1 0.900 - - OOG6_102593
Panther 1 1.100 - - LDO PTHR13120
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2842
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.