DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Daxx and Daxx

Sequence 1:NP_001285675.1 Gene:Daxx FlyBaseID:FBgn0031820 Length:1659 Species:Drosophila melanogaster
Sequence 2:XP_006256165.1 Gene:Daxx RGDID:621227 Length:738 Species:Rattus norvegicus

Alignment Length:596 Identity:146/597 (24%)
Similarity:234/597 (39%) Gaps:145/597 (24%)


  Fly  1052 MATDKQSRAIKRPAVMISTKKSGLVVTEIVDLDEIPDIPPEKRGKECFPPIKNAAKAAPSVNAPF 1116
            ||||                 ..::|.:..|.||....|....      |..|.....|..:.|.
  Rat     1 MATD-----------------DSIIVLDDDDEDEAAAQPGPSN------PASNPVSPGPEASGPS 42

  Fly  1117 TTE---------------------YAALLRLCREVDKSTHMERLVKGELTQYYYSAPESFVMSCG 1160
            .:.                     :...|.||: :..|.|.|  |...|.:....|..:|:.|..
  Rat    43 ESHGDGGSSNSGSRKCYKLENEKLFEEFLELCK-MQTSDHPE--VVPFLHKLQQRAQSAFLASAE 104

  Fly  1161 FRNLVTMAMARIRSESYLVYVHLKYVLDELASRRLTKMFPTVRAIPPASQFPLPPASQFPLPPTL 1225
            |||:::..::|.|:....:||::..:...|.:..:.|......|....|....||..    ||: 
  Rat   105 FRNILSRVLSRSRNRPAKLYVYINELCTVLKAHSIKKKLNLAPAASAESSGDNPPTD----PPS- 164

  Fly  1226 TTPKQPAIVKAPGQQTVMAGREQDDEVEEVTLVNVGTVSCE-ERRRDER--IRHFYRTLHAITKR 1287
                                          .|.|..|.:.| .|.|..|  |:...:.|......
  Rat   165 ------------------------------DLTNTETTASEASRTRGSRRQIQRLEQLLALYVAE 199

  Fly  1288 IKMLEEAEVD---LNDEDSSYLQLERFKKRACQIYEKICDLKGESKSVRRQLKKPIHFKDSDYPH 1349
            |:.|:|.|:|   |:|.||||||..|.|::..:::.::|:||..|....|.:::.|.::.:.||.
  Rat   200 IQRLQEKELDLSELDDPDSSYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPE 264

  Fly  1350 FNNSLSAFVNR--MQDFPDYHDVLQILEKCNKEKELGLAKYEMKRIAYDAFNKVGRMLQSRRKND 1412
            .|..:...:|:  ...||||.|||:.:||......|||.:.:::.:|.|||..||..||.||..|
  Rat   265 VNRRIERLINKPGPDTFPDYGDVLRAVEKAATRHSLGLPRQQLQLLAQDAFRDVGVRLQERRHLD 329

  Fly  1413 L-YETVTHYTAN---GKDPASSDPELLAKLKENNK-KQTKISDILEKYALEQDLNAE-ERQEARL 1471
            | |....|.|.:   |.|||.:||.|..:|:||.. ..:::.:::.|||:.||.:.| |||:.| 
  Rat   330 LIYNFGCHLTDDYRPGVDPALTDPTLARRLRENRTLAMSRLDEVISKYAMMQDKSEEGERQKRR- 393

  Fly  1472 KEKKLKQVKADEEAAKLAALAEDDDKPCTSAQAAAKAAALAALKRGPAARGNVIRKKRAANGRIF 1536
                          |:|.|.::..|.|..|:.:....:.:|:.:.....:..             
  Rat   394 --------------ARLLATSQSSDLPKASSDSGEGPSGVASQEDPTTPKAE------------- 431

  Fly  1537 KIADDGDDSEEESDSEDDDVEEFVNNFQANSDVSDADSEVEAVTSPKRDALPLAEEEDVIDITRD 1601
              .:|.:|.||..|.|:::.||                |.||......|...|.|::   |...:
  Rat   432 --TEDEEDDEESDDEEEEEEEE----------------EEEATEDEDEDLEQLQEDQ---DDEEE 475

  Fly  1602 ETGKKNDEGTP 1612
            |.|...|:.:|
  Rat   476 EEGDNEDDKSP 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DaxxNP_001285675.1 DAXX_histone_binding 1276..1462 CDD:240523 68/196 (35%)
DaxxXP_006256165.1 Daxx 56..146 CDD:281355 21/111 (19%)
DAXX_histone_binding 181..385 CDD:240523 68/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C309425508
eggNOG 1 0.900 E1_28JDB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006969
OrthoInspector 1 1.000 T1088100
orthoMCL 1 0.900 OOG5_134963
Panther 1 1.100 LDO PTHR12766
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.790

Return to query results.
Submit another query.