DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Daxx and Daxx

Sequence 1:NP_001285675.1 Gene:Daxx FlyBaseID:FBgn0031820 Length:1659 Species:Drosophila melanogaster
Sequence 2:NP_001186662.1 Gene:Daxx MGIID:1197015 Length:740 Species:Mus musculus

Alignment Length:604 Identity:151/605 (25%)
Similarity:238/605 (39%) Gaps:148/605 (24%)


  Fly  1052 MATDKQSRAIKRPAVMISTKKSGLVVTEIVDLDEIPDIPPEKRGKECFPPIKNAAKAAP----SV 1112
            ||||                 ..::|.:..|.||....|    |....||  |.|...|    |.
Mouse     1 MATD-----------------DSIIVLDDDDEDEAAAQP----GPSNLPP--NPASTGPGPGLSQ 42

  Fly  1113 NAPFTTE-----------------------YAALLRLCREVDKSTHMERLVKGELTQYYYSAPES 1154
            .|...:|                       :...|.||: .:.|.|.|  |...|.:....|...
Mouse    43 QATGLSEPRVDGGSSNSGSRKCYKLDNEKLFEEFLELCK-TETSDHPE--VVPFLHKLQQRAQSV 104

  Fly  1155 FVMSCGFRNLVTMAMARIRSESYLVYVHLKYVLDELASRRLTKMFPTVRAIPPASQF--PLPPAS 1217
            |:.|..|.|:::..:||.|.....:||::..:...|.:..:.|......|....|:.  |.||..
Mouse   105 FLASAEFCNILSRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTE 169

  Fly  1218 QFPLPPTLTTPKQPAIVKAPGQQTVMAGREQDDEVEEVTLVNVGTVSCEERRRDER--IRHFYRT 1280
                ||:..|..:                              .|.|...|.|..|  |:...:.
Mouse   170 ----PPSDLTNTE------------------------------NTASEASRTRGSRRQIQRLEQL 200

  Fly  1281 LHAITKRIKMLEEAEVD---LNDEDSSYLQLERFKKRACQIYEKICDLKGESKSVRRQLKKPIHF 1342
            |......|:.|:|.|:|   |:|.||||||..|.|::..:::.::|:||..|....|.:::.|.:
Mouse   201 LALYVAEIRRLQEKELDLSELDDPDSSYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPY 265

  Fly  1343 KDSDYPHFNNSLSAFVNR--MQDFPDYHDVLQILEKCNKEKELGLAKYEMKRIAYDAFNKVGRML 1405
            :.:.||..|..:...:|:  :..||||.|||:.:||......|||.:.:::.:|.|||..||..|
Mouse   266 RGTRYPEVNRRIERLINKPGLDTFPDYGDVLRAVEKAATRHSLGLPRQQLQLLAQDAFRDVGVRL 330

  Fly  1406 QSRRKNDL-YETVTHYTAN---GKDPASSDPELLAKLKENNK-KQTKISDILEKYALEQDLNAE- 1464
            |.||..|| |....|.|.:   |.|||.|||.|..:|:||.. ...::.:::.|||:.||...| 
Mouse   331 QERRHLDLIYNFGCHLTDDYRPGVDPALSDPTLARRLRENRTLAMNRLDEVISKYAMMQDKTEEG 395

  Fly  1465 ERQEARLKEKKLKQVKADEEAAKLAALAEDDDKPCTSAQAAAKAAALAALKRGPAARGNVIRKKR 1529
            |||:.|              |..|....:..|.|..|:::....:.:|:.:....::..      
Mouse   396 ERQKRR--------------ARLLGTAPQPSDPPKASSESGEGPSGMASQECPTTSKAE------ 440

  Fly  1530 AANGRIFKIADDGDDSEEESDSEDDDVEEFVNNFQANSDVSDADSEVEAVTSPKRDALPLAEEED 1594
                     .||.||.:::.|.||        |.::..:..:.:.|.||...         |:||
Mouse   441 ---------TDDDDDDDDDDDDED--------NEESEEEEEEEEEEKEATED---------EDED 479

  Fly  1595 VIDITRDETGKKNDEGTPN 1613
            :..:..|:.|.:.:||..|
Mouse   480 LEQLQEDQGGDEEEEGGDN 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DaxxNP_001285675.1 DAXX_histone_binding 1276..1462 CDD:240523 69/196 (35%)
DaxxNP_001186662.1 Necessary for interaction with USP7 and ATRX. {ECO:0000250} 1..166 43/194 (22%)
Daxx 54..152 CDD:308771 25/125 (20%)
Interaction with histone H3.3. {ECO:0000250} 189..423 80/247 (32%)
DAXX_histone_binding 189..393 CDD:240523 70/216 (32%)
Nuclear localization signal. {ECO:0000255} 391..395 0/5 (0%)
Nuclear localization signal. {ECO:0000255} 623..629
Interaction with SPOP. {ECO:0000250} 627..740
Sumo interaction motif (SIM). {ECO:0000250} 733..740
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C309423077
eggNOG 1 0.900 E1_28JDB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006969
OrthoInspector 1 1.000 T1084554
orthoMCL 1 0.900 OOG5_134963
Panther 1 1.100 LDO PTHR12766
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5527
TreeFam 1 0.960
87.820

Return to query results.
Submit another query.