DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sec61alpha and SPBC19G7.17

Sequence 1:NP_001285674.1 Gene:Sec61alpha FlyBaseID:FBgn0086357 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_595983.2 Gene:SPBC19G7.17 PomBaseID:SPBC19G7.17 Length:475 Species:Schizosaccharomyces pombe

Alignment Length:476 Identity:151/477 (32%)
Similarity:261/477 (55%) Gaps:14/477 (3%)


  Fly     2 GIKFLEVIKPFCSILPEIAKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWIR 66
            |.:|:..|||..|:|||:..|:..::..||:.|.|..:.::.:...||::|...:|:.||....|
pombe     3 GARFINFIKPLSSLLPEVEGPKTHLELVEKLGWMAGCVVVYQILSIIPVYGAEKTDTLDPINNFR 67

  Fly    67 VILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVG-DTPKDRALFNGAQKLFGMVITIGQAIV 130
            |:..|:...||..|::||..|..::|:||..|.|.|. :...||.||..|||:...::.:..|:.
pombe    68 VLDGSSASGLMITGLAPIYLSSFLLQILASKKKIAVNFNLIIDRVLFQNAQKVVSALLYLILAVT 132

  Fly   131 YVMTGMYGDPSEIGAGVCLLIIIQLFAAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKA 195
            ||.:|.||..|::|....:::|:|:|..|::.:.|.|:::||:|||||..|.:.::|...|:|..
pombe   133 YVSSGYYGSFSDLGIFRFIMLILQIFLPGIVCIYLCEIIEKGHGLGSGPVLLLGSHILGNIMWDV 197

  Fly   196 FS----PTTVTTGRGTEFEGAVIAL-FHLMATRNDKVRALREAFYRQNLPNLMNLLATVLVFAVV 255
            .|    |  |.....::::||::.. |:|.:.:| |..:||...:|....:.:..|..:.|||..
pombe   198 LSLHRYP--VNESGDSQYQGALVGFAFNLFSFKN-KFSSLRSILFRSEGLSFVQFLVCIAVFATF 259

  Fly   256 IYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAVKFQGNFFINL 320
            :|....|:|:||:|:|.||...::|:||.|||.||:|...:::|:|.|.:..|......:....|
pombe   260 MYTLNIRIDVPIRSSRVRGVRQNFPLKLLYTSVIPLIYFYSILSHLLVFAYALYSLCPNSLITRL 324

  Fly   321 LGVWADVGGGGPARSYPIGGLCYYLSPPESVGHILTDPIHALLYIVFMLGSCAFFSKTWIDVSGS 385
            |..::.:......:...:|||.|:|.||..:...|..|:|.::|.:.::....:||..|::.:..
pombe   325 LVQYSPIDTFAEHKLQLVGGLVYFLYPPLGLSEALLHPVHTVIYTITLICITIYFSLLWMNATAG 389

  Fly   386 SAKDVAKQLKEQHMVMRGHRENSMIHELNRYIPTAAAFGGLCIGALSVMADFLGAIGS--GTGIL 448
            ..:||....||..:|:.|:||.:|:.||.:.||.||......:..|||:|   |...|  |.|:|
pombe   390 GPRDVLLFFKENQLVIAGYREATMLKELEKIIPIAAKLSAFFVSILSVIA---GIFASTFGVGVL 451

  Fly   449 LAVTIIYQYFEIFVKEQSEMG 469
            :|..::|..||:.|...:.:|
pombe   452 IASALVYASFEMIVGANTSLG 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sec61alphaNP_001285674.1 PTZ00219 1..469 CDD:185519 150/475 (32%)
SPBC19G7.17NP_595983.2 PTZ00219 3..465 CDD:185519 149/468 (32%)
Plug_translocon 41..73 CDD:287522 9/32 (28%)
SecY 77..453 CDD:278759 122/382 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10906
Phylome 1 0.910 0.766 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.970

Return to query results.
Submit another query.