DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and CG10559

DIOPT Version :8

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster

Alignment Length:406 Identity:97/407 (24%)
Similarity:172/407 (42%) Gaps:74/407 (18%)


  Fly    12 AP-PSHLDVPFFEEVLETALRTARVQLLSIHIRMGSSTGENYCSQIYRVKVSFKRPDHPEQHMAF 75
            || |:.|....|||:|..........:.|.....|...||||.:.:.|:|:..:..||..:::::
  Fly     8 APMPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSY 72

  Fly    76 IVKSIPHLDSVEFIDDLQVYLK----------EKITYYEVLPRLELLMQ---CNRRFGPKLYHYL 127
            ::|: |:        |.::|.:          |:..:.:|:|.||.:.:   ...:||.|.|. :
  Fly    73 MLKT-PY--------DFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYE-I 127

  Fly   128 KQPENSLVFEDLAEKGFVMASRELGLNEEHCQLVMERLAEFHATSMALAVVDPHIFDAYGDGMLS 192
            ..|::.::.:||...||....|..||:..|.:.|::::|::||.|....    |:...|....|.
  Fly   128 DAPDDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRI----HLKGPYPQNYLQ 188

  Fly   193 PRGLAKDDGLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKYM----------QNQRANLERSQ- 246
            |.            ::...||         ..|::||.:|||.          :...|.:.:.| 
  Fly   189 PT------------YADTMKE---------SIEQVAETLGKYFLKCLPLYEGYEEYSAAVHKMQP 232

  Fly   247 ----------APQEKEVKVLNHGDLWVNNMLFKY-DGAQRPQDLILIDFQLSVWGSPGIDLNYFF 300
                      .|..::...|||||.|.:|::||| |.:..|.:...:|.||....|...||.||.
  Fly   233 KIVDLMYAMNTPDPQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFL 297

  Fly   301 YTSLTLEVLRHRRTQLLRTYHARLAKTLLDLDM-GIPVPSYEQILEEVHRRESYGFFASYGIFPT 364
            ..|...|:...:....::.||..|.:.|..|:. ....|:...:..::.:....|:..::.:.|.
  Fly   298 LGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPP 362

  Fly   365 VSQDKAQTADNNLENF 380
            |..|:  |.|.||.:|
  Fly   363 VLLDR--TEDANLTDF 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 76/317 (24%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 77/320 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55149
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.