DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and CG5644

DIOPT Version :8

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster

Alignment Length:395 Identity:101/396 (26%)
Similarity:153/396 (39%) Gaps:104/396 (26%)


  Fly    45 GSSTGENYCSQIYRVKVSFKRPDH-PE----QHMAFIVK-SIPHLDSVEFIDDLQVYLKEKITYY 103
            |||:|:||.|.:.||.:|....|. ||    :.:..||| .|..|...:.....:.:..|...|.
  Fly    61 GSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVTVIVKRQIASLSRRQLYRCEEAFSNEINAYR 125

  Fly   104 EVLP------RLELLMQC------NRRFGPKLYHYLKQPENSLVFEDLAEKGFVMASRELGLNEE 156
            .:.|      |.:|...|      :||..       :..|..:|.:||...||.|..|..||...
  Fly   126 HLAPLLAAHSRHQLFPVCHIAESQDRRDA-------EGGEPIIVLQDLKAMGFRMKDRLAGLELS 183

  Fly   157 HCQLVMERLAEFHATSMALAVVDPHIFDAYGDGMLSPRGLAKDDGLLMQFFSGNGKELHH----- 216
            .|.|||::||:.||.|:|...::...|..:.|.:                     :|:.:     
  Fly   184 DCLLVMKKLAQLHAASLAAQELESSSFAFHADHL---------------------QEIVYCDEAT 227

  Fly   217 -----LVSTWPGFEKIAEKIG------------KYMQNQRANL---------ERSQAPQEKEVKV 255
                 ::.|  ..::..|.:|            :.::..|.||         ..:.||.    .|
  Fly   228 DFYATILDT--SVQQALESLGDANADDCLTTPIRLLEELRTNLFENLKHEINATAAAPN----SV 286

  Fly   256 LNHGDLWVNNMLFKYDGAQRPQDLILIDFQLSVWGSPGIDLNYFFYTSLTLEVLRHRRTQ-LLRT 319
            :.||||||||::|:    ..|:::|..|.|.....||..|:.:|.||| |...||...|. ||..
  Fly   287 ICHGDLWVNNIMFR----SEPEEVIFFDLQAMRKSSPIFDILHFIYTS-TRRPLRDVHTDTLLAA 346

  Fly   320 YHARLAKTLL-DLDMGIPVPSYEQILE---------EVHRRESYGFFASYGIFPTVSQDKAQTAD 374
            |...|::.|. .|:........|::.|         :..|:..||......|.|.|:.|     .
  Fly   347 YSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYGLAIGMWILPAVTFD-----P 406

  Fly   375 NNLEN 379
            |||.|
  Fly   407 NNLPN 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 84/333 (25%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 84/331 (25%)
P-loop_NTPase <357..435 CDD:304359 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.